Anti CHI3L2 pAb (ATL-HPA005443)

Atlas Antibodies

Catalog No.:
ATL-HPA005443-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chitinase 3-like 2
Gene Name: CHI3L2
Alternative Gene Name: YKL-39, YKL39
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062778: 45%, ENSRNOG00000053272: 47%
Entrez Gene ID: 1117
Uniprot ID: Q15782
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IDPFLCSHLIYSFASIENNKVIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKER
Gene Sequence IDPFLCSHLIYSFASIENNKVIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKER
Gene ID - Mouse ENSMUSG00000062778
Gene ID - Rat ENSRNOG00000053272
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHI3L2 pAb (ATL-HPA005443)
Datasheet Anti CHI3L2 pAb (ATL-HPA005443) Datasheet (External Link)
Vendor Page Anti CHI3L2 pAb (ATL-HPA005443) at Atlas Antibodies

Documents & Links for Anti CHI3L2 pAb (ATL-HPA005443)
Datasheet Anti CHI3L2 pAb (ATL-HPA005443) Datasheet (External Link)
Vendor Page Anti CHI3L2 pAb (ATL-HPA005443)