Anti CHI3L2 pAb (ATL-HPA005443)
Atlas Antibodies
- Catalog No.:
- ATL-HPA005443-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CHI3L2
Alternative Gene Name: YKL-39, YKL39
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062778: 45%, ENSRNOG00000053272: 47%
Entrez Gene ID: 1117
Uniprot ID: Q15782
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IDPFLCSHLIYSFASIENNKVIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKER |
Gene Sequence | IDPFLCSHLIYSFASIENNKVIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKER |
Gene ID - Mouse | ENSMUSG00000062778 |
Gene ID - Rat | ENSRNOG00000053272 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CHI3L2 pAb (ATL-HPA005443) | |
Datasheet | Anti CHI3L2 pAb (ATL-HPA005443) Datasheet (External Link) |
Vendor Page | Anti CHI3L2 pAb (ATL-HPA005443) at Atlas Antibodies |
Documents & Links for Anti CHI3L2 pAb (ATL-HPA005443) | |
Datasheet | Anti CHI3L2 pAb (ATL-HPA005443) Datasheet (External Link) |
Vendor Page | Anti CHI3L2 pAb (ATL-HPA005443) |