Anti CHI3L1 pAb (ATL-HPA077365)

Atlas Antibodies

Catalog No.: ATL-HPA077365-25

Protein Description: chitinase 3 like 1
Gene Name: CHI3L1
Alternative Gene Name: GP39, YKL40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064246: 76%, ENSRNOG00000053272: 79%
Entrez Gene ID: 1116
Uniprot ID: P36222
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DGLDLAWLYPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHL
• Gene Sequence: DGLDLAWLYPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHL
• Gene ID - Mouse: ENSMUSG00000064246
• Gene ID - Rat: ENSRNOG00000053272
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.