Anti CHI3L1 pAb (ATL-HPA077365)

Atlas Antibodies

Catalog No.:
ATL-HPA077365-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chitinase 3 like 1
Gene Name: CHI3L1
Alternative Gene Name: GP39, YKL40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064246: 76%, ENSRNOG00000053272: 79%
Entrez Gene ID: 1116
Uniprot ID: P36222
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DGLDLAWLYPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHL
Gene Sequence DGLDLAWLYPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHL
Gene ID - Mouse ENSMUSG00000064246
Gene ID - Rat ENSRNOG00000053272
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHI3L1 pAb (ATL-HPA077365)
Datasheet Anti CHI3L1 pAb (ATL-HPA077365) Datasheet (External Link)
Vendor Page Anti CHI3L1 pAb (ATL-HPA077365) at Atlas Antibodies

Documents & Links for Anti CHI3L1 pAb (ATL-HPA077365)
Datasheet Anti CHI3L1 pAb (ATL-HPA077365) Datasheet (External Link)
Vendor Page Anti CHI3L1 pAb (ATL-HPA077365)