Anti CHGB pAb (ATL-HPA012602 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA012602-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CHGB
Alternative Gene Name: SCG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027350: 57%, ENSRNOG00000021269: 57%
Entrez Gene ID: 1114
Uniprot ID: P05060
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SEVDKRRTRPRHHHGRSRPDRSSQGGSLPSEEKGHPQEESEESNVSMASLGEKRDHHSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESE |
| Gene Sequence | SEVDKRRTRPRHHHGRSRPDRSSQGGSLPSEEKGHPQEESEESNVSMASLGEKRDHHSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESE |
| Gene ID - Mouse | ENSMUSG00000027350 |
| Gene ID - Rat | ENSRNOG00000021269 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CHGB pAb (ATL-HPA012602 w/enhanced validation) | |
| Datasheet | Anti CHGB pAb (ATL-HPA012602 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CHGB pAb (ATL-HPA012602 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CHGB pAb (ATL-HPA012602 w/enhanced validation) | |
| Datasheet | Anti CHGB pAb (ATL-HPA012602 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CHGB pAb (ATL-HPA012602 w/enhanced validation) |
| Citations for Anti CHGB pAb (ATL-HPA012602 w/enhanced validation) – 2 Found |
| Lind, Anne-Li; Just, David; Mikus, Maria; Fredolini, Claudia; Ioannou, Marina; Gerdle, Björn; Ghafouri, Bijar; Bäckryd, Emmanuel; Tanum, Lars; Gordh, Torsten; Månberg, Anna. CSF levels of apolipoprotein C1 and autotaxin found to associate with neuropathic pain and fibromyalgia. Journal Of Pain Research. 12( 31686904):2875-2889. PubMed |
| Sanson, Romain; Lazzara, Silvia Luna; Cune, David; Pitasi, Caterina Luana; Trentesaux, Coralie; Fraudeau, Marie; Letourneur, Franck; Saintpierre, Benjamin; Le Gall, Morgane; Bossard, Pascale; Terris, Benoit; Finetti, Pascal; Bertucci, François; Mamessier, Emilie; Romagnolo, Béatrice; Perret, Christine. Axin1 Protects Colon Carcinogenesis by an Immune-Mediated Effect. Cellular And Molecular Gastroenterology And Hepatology. 15(3):689-715. PubMed |