Anti CHGB pAb (ATL-HPA012602 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA012602-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromogranin B (secretogranin 1)
Gene Name: CHGB
Alternative Gene Name: SCG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027350: 57%, ENSRNOG00000021269: 57%
Entrez Gene ID: 1114
Uniprot ID: P05060
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SEVDKRRTRPRHHHGRSRPDRSSQGGSLPSEEKGHPQEESEESNVSMASLGEKRDHHSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESE
Gene Sequence SEVDKRRTRPRHHHGRSRPDRSSQGGSLPSEEKGHPQEESEESNVSMASLGEKRDHHSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESE
Gene ID - Mouse ENSMUSG00000027350
Gene ID - Rat ENSRNOG00000021269
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHGB pAb (ATL-HPA012602 w/enhanced validation)
Datasheet Anti CHGB pAb (ATL-HPA012602 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CHGB pAb (ATL-HPA012602 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CHGB pAb (ATL-HPA012602 w/enhanced validation)
Datasheet Anti CHGB pAb (ATL-HPA012602 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CHGB pAb (ATL-HPA012602 w/enhanced validation)
Citations for Anti CHGB pAb (ATL-HPA012602 w/enhanced validation) – 2 Found
Lind, Anne-Li; Just, David; Mikus, Maria; Fredolini, Claudia; Ioannou, Marina; Gerdle, Björn; Ghafouri, Bijar; Bäckryd, Emmanuel; Tanum, Lars; Gordh, Torsten; Månberg, Anna. CSF levels of apolipoprotein C1 and autotaxin found to associate with neuropathic pain and fibromyalgia. Journal Of Pain Research. 12( 31686904):2875-2889.  PubMed
Sanson, Romain; Lazzara, Silvia Luna; Cune, David; Pitasi, Caterina Luana; Trentesaux, Coralie; Fraudeau, Marie; Letourneur, Franck; Saintpierre, Benjamin; Le Gall, Morgane; Bossard, Pascale; Terris, Benoit; Finetti, Pascal; Bertucci, François; Mamessier, Emilie; Romagnolo, Béatrice; Perret, Christine. Axin1 Protects Colon Carcinogenesis by an Immune-Mediated Effect. Cellular And Molecular Gastroenterology And Hepatology. 15(3):689-715.  PubMed