Anti CHFR pAb (ATL-HPA073826)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073826-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CHFR
Alternative Gene Name: FLJ10796, RNF196
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014668: 97%, ENSRNOG00000037430: 96%
Entrez Gene ID: 55743
Uniprot ID: Q96EP1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSDISQPYVVCRQCPEYRR |
| Gene Sequence | AYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSDISQPYVVCRQCPEYRR |
| Gene ID - Mouse | ENSMUSG00000014668 |
| Gene ID - Rat | ENSRNOG00000037430 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CHFR pAb (ATL-HPA073826) | |
| Datasheet | Anti CHFR pAb (ATL-HPA073826) Datasheet (External Link) |
| Vendor Page | Anti CHFR pAb (ATL-HPA073826) at Atlas Antibodies |
| Documents & Links for Anti CHFR pAb (ATL-HPA073826) | |
| Datasheet | Anti CHFR pAb (ATL-HPA073826) Datasheet (External Link) |
| Vendor Page | Anti CHFR pAb (ATL-HPA073826) |