Anti CHFR pAb (ATL-HPA073826)

Atlas Antibodies

Catalog No.:
ATL-HPA073826-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: checkpoint with forkhead and ring finger domains
Gene Name: CHFR
Alternative Gene Name: FLJ10796, RNF196
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014668: 97%, ENSRNOG00000037430: 96%
Entrez Gene ID: 55743
Uniprot ID: Q96EP1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSDISQPYVVCRQCPEYRR
Gene Sequence AYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSDISQPYVVCRQCPEYRR
Gene ID - Mouse ENSMUSG00000014668
Gene ID - Rat ENSRNOG00000037430
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHFR pAb (ATL-HPA073826)
Datasheet Anti CHFR pAb (ATL-HPA073826) Datasheet (External Link)
Vendor Page Anti CHFR pAb (ATL-HPA073826) at Atlas Antibodies

Documents & Links for Anti CHFR pAb (ATL-HPA073826)
Datasheet Anti CHFR pAb (ATL-HPA073826) Datasheet (External Link)
Vendor Page Anti CHFR pAb (ATL-HPA073826)