Anti CHFR pAb (ATL-HPA073826)

Atlas Antibodies

Catalog No.: ATL-HPA073826-25

Protein Description: checkpoint with forkhead and ring finger domains
Gene Name: CHFR
Alternative Gene Name: FLJ10796, RNF196
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014668: 97%, ENSRNOG00000037430: 96%
Entrez Gene ID: 55743
Uniprot ID: Q96EP1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSDISQPYVVCRQCPEYRR
• Gene Sequence: AYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSDISQPYVVCRQCPEYRR
• Gene ID - Mouse: ENSMUSG00000014668
• Gene ID - Rat: ENSRNOG00000037430
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.