Anti CHD9 pAb (ATL-HPA042053)

Atlas Antibodies

Catalog No.:
ATL-HPA042053-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromodomain helicase DNA binding protein 9
Gene Name: CHD9
Alternative Gene Name: BC022889, FLJ12178, KIAA0308
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056608: 85%, ENSRNOG00000049302: 81%
Entrez Gene ID: 80205
Uniprot ID: Q3L8U1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HQVESQTEPFTGLDPEDLLQEGLLPHFDESTFGQDNSSHILDHDLDRQFTSHLVTRPSDMAQTQLQSQARSWHSSFSNHQHLHDRNHLCLQRQPPSSKKSDGSGTYTKLQNTQV
Gene Sequence HQVESQTEPFTGLDPEDLLQEGLLPHFDESTFGQDNSSHILDHDLDRQFTSHLVTRPSDMAQTQLQSQARSWHSSFSNHQHLHDRNHLCLQRQPPSSKKSDGSGTYTKLQNTQV
Gene ID - Mouse ENSMUSG00000056608
Gene ID - Rat ENSRNOG00000049302
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHD9 pAb (ATL-HPA042053)
Datasheet Anti CHD9 pAb (ATL-HPA042053) Datasheet (External Link)
Vendor Page Anti CHD9 pAb (ATL-HPA042053) at Atlas Antibodies

Documents & Links for Anti CHD9 pAb (ATL-HPA042053)
Datasheet Anti CHD9 pAb (ATL-HPA042053) Datasheet (External Link)
Vendor Page Anti CHD9 pAb (ATL-HPA042053)