Anti CHD5 pAb (ATL-HPA055477)

Atlas Antibodies

Catalog No.:
ATL-HPA055477-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromodomain helicase DNA binding protein 5
Gene Name: CHD5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005045: 67%, ENSRNOG00000011268: 67%
Entrez Gene ID: 26038
Uniprot ID: Q8TDI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GYMDEKDPGAQKPRQPLEVQALPAALDRVESEDKHESPASKERAREERPEETEKAPPSPEQLPREEVLPEKEKILDKLELSLIHSR
Gene Sequence GYMDEKDPGAQKPRQPLEVQALPAALDRVESEDKHESPASKERAREERPEETEKAPPSPEQLPREEVLPEKEKILDKLELSLIHSR
Gene ID - Mouse ENSMUSG00000005045
Gene ID - Rat ENSRNOG00000011268
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHD5 pAb (ATL-HPA055477)
Datasheet Anti CHD5 pAb (ATL-HPA055477) Datasheet (External Link)
Vendor Page Anti CHD5 pAb (ATL-HPA055477) at Atlas Antibodies

Documents & Links for Anti CHD5 pAb (ATL-HPA055477)
Datasheet Anti CHD5 pAb (ATL-HPA055477) Datasheet (External Link)
Vendor Page Anti CHD5 pAb (ATL-HPA055477)