Anti CHD3 pAb (ATL-HPA043368)

Atlas Antibodies

SKU:
ATL-HPA043368-25
  • Immunohistochemical staining of human cerebral cortex shows distinct nuclear positivity in neuronal cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromodomain helicase DNA binding protein 3
Gene Name: CHD3
Alternative Gene Name: Mi-2a, Mi2-ALPHA, ZFH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018474: 88%, ENSRNOG00000009722: 89%
Entrez Gene ID: 1107
Uniprot ID: Q12873
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKIKLGLLGGKREKGGSYVFQSDEGPEPEAEESDLDSGSVHSASGRPDGPVRTKKLKRGRPGRKKKKLLGCPA
Gene Sequence LKIKLGLLGGKREKGGSYVFQSDEGPEPEAEESDLDSGSVHSASGRPDGPVRTKKLKRGRPGRKKKKLLGCPA
Gene ID - Mouse ENSMUSG00000018474
Gene ID - Rat ENSRNOG00000009722
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CHD3 pAb (ATL-HPA043368)
Datasheet Anti CHD3 pAb (ATL-HPA043368) Datasheet (External Link)
Vendor Page Anti CHD3 pAb (ATL-HPA043368) at Atlas Antibodies

Documents & Links for Anti CHD3 pAb (ATL-HPA043368)
Datasheet Anti CHD3 pAb (ATL-HPA043368) Datasheet (External Link)
Vendor Page Anti CHD3 pAb (ATL-HPA043368)