Anti CHD1L pAb (ATL-HPA028670 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA028670-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: chromodomain helicase DNA binding protein 1-like
Gene Name: CHD1L
Alternative Gene Name: ALC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028089: 76%, ENSRNOG00000017669: 78%
Entrez Gene ID: 9557
Uniprot ID: Q86WJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTLLEKASQEGRSLRNKGSVLIPGLVEGSTKRKRVLSPEELEDRQKKRQEAAAKRRRLIEEKKR
Gene Sequence GSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTLLEKASQEGRSLRNKGSVLIPGLVEGSTKRKRVLSPEELEDRQKKRQEAAAKRRRLIEEKKR
Gene ID - Mouse ENSMUSG00000028089
Gene ID - Rat ENSRNOG00000017669
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHD1L pAb (ATL-HPA028670 w/enhanced validation)
Datasheet Anti CHD1L pAb (ATL-HPA028670 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CHD1L pAb (ATL-HPA028670 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CHD1L pAb (ATL-HPA028670 w/enhanced validation)
Datasheet Anti CHD1L pAb (ATL-HPA028670 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CHD1L pAb (ATL-HPA028670 w/enhanced validation)
Citations for Anti CHD1L pAb (ATL-HPA028670 w/enhanced validation) – 2 Found
Wang, Wei; Wu, Jiayi; Fei, Xiaochun; Chen, Weiguo; Li, Yafen; Shen, Kunwei; Zhu, Li. CHD1L promotes cell cycle progression and cell motility by up-regulating MDM2 in breast cancer. American Journal Of Translational Research. 11(3):1581-1592.  PubMed
Brockschmidt, Antje; Chung, Boidinh; Weber, Stefanie; Fischer, Dagmar-Christiane; Kolatsi-Joannou, Maria; Christ, Laura; Heimbach, André; Shtiza, Diamant; Klaus, Günter; Simonetti, Giacomo D; Konrad, Martin; Winyard, Paul; Haffner, Dieter; Schaefer, Franz; Weber, Ruthild G. CHD1L: a new candidate gene for congenital anomalies of the kidneys and urinary tract (CAKUT). Nephrology, Dialysis, Transplantation : Official Publication Of The European Dialysis And Transplant Association - European Renal Association. 2012;27(6):2355-64.  PubMed