Anti CHD1 pAb (ATL-HPA022236 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022236-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CHD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023852: 90%, ENSRNOG00000014434: 88%
Entrez Gene ID: 1105
Uniprot ID: O14646
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QESQQNSDQNSNLNPHVIRNPDVERLKENTNHDDSSRDSYSSDRHLTQYHDHHKDRHQGDSYKKSDSRKRPYSSFSNGKDHRDWDHYKQDSRYYSDREKHRKLDDHRSRDHRSNLEGSL |
| Gene Sequence | QESQQNSDQNSNLNPHVIRNPDVERLKENTNHDDSSRDSYSSDRHLTQYHDHHKDRHQGDSYKKSDSRKRPYSSFSNGKDHRDWDHYKQDSRYYSDREKHRKLDDHRSRDHRSNLEGSL |
| Gene ID - Mouse | ENSMUSG00000023852 |
| Gene ID - Rat | ENSRNOG00000014434 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CHD1 pAb (ATL-HPA022236 w/enhanced validation) | |
| Datasheet | Anti CHD1 pAb (ATL-HPA022236 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CHD1 pAb (ATL-HPA022236 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CHD1 pAb (ATL-HPA022236 w/enhanced validation) | |
| Datasheet | Anti CHD1 pAb (ATL-HPA022236 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CHD1 pAb (ATL-HPA022236 w/enhanced validation) |
| Citations for Anti CHD1 pAb (ATL-HPA022236 w/enhanced validation) – 4 Found |
| Zhao, Di; Lu, Xin; Wang, Guocan; Lan, Zhengdao; Liao, Wenting; Li, Jun; Liang, Xin; Chen, Jasper Robin; Shah, Sagar; Shang, Xiaoying; Tang, Ming; Deng, Pingna; Dey, Prasenjit; Chakravarti, Deepavali; Chen, Peiwen; Spring, Denise J; Navone, Nora M; Troncoso, Patricia; Zhang, Jianhua; Wang, Y Alan; DePinho, Ronald A. Synthetic essentiality of chromatin remodelling factor CHD1 in PTEN-deficient cancer. Nature. 2017;542(7642):484-488. PubMed |
| Ormond, D Ryan; Kleinschmidt-DeMasters, B K; Cavalcante, Daniel; Smith, Elizabeth E; Cramer, Scott D; Lucia, M Scott. Prostatic adenocarcinoma CNS parenchymal and dural metastases: alterations in ERG, CHD1 and MAP3K7 expression. Journal Of Neuro-Oncology. 2019;142(2):319-325. PubMed |
| Zhao, Di; Cai, Li; Lu, Xin; Liang, Xin; Li, Jiexi; Chen, Peiwen; Ittmann, Michael; Shang, Xiaoying; Jiang, Shan; Li, Haoyan; Meng, Chenling; Flores, Ivonne; Song, Jian H; Horner, James W; Lan, Zhengdao; Wu, Chang-Jiun; Li, Jun; Chang, Qing; Chen, Ko-Chien; Wang, Guocan; Deng, Pingna; Spring, Denise J; Wang, Y Alan; DePinho, Ronald A. Chromatin Regulator CHD1 Remodels the Immunosuppressive Tumor Microenvironment in PTEN-Deficient Prostate Cancer. Cancer Discovery. 2020;10(9):1374-1387. PubMed |
| Li, Haoyan; Wang, Yin; Lin, Kevin; Venkadakrishnan, Varadha Balaji; Bakht, Martin; Shi, Wei; Meng, Chenling; Zhang, Jie; Tremble, Kaitlyn; Liang, Xin; Song, Jian H; Feng, Xu; Van, Vivien; Deng, Pingna; Burks, Jared K; Aparicio, Ana; Keyomarsi, Khandan; Chen, Junjie; Lu, Yue; Beltran, Himisha; Zhao, Di. CHD1 Promotes Sensitivity to Aurora Kinase Inhibitors by Suppressing Interaction of AURKA with Its Coactivator TPX2. Cancer Research. 2022;82(17):3088-3101. PubMed |