Anti CHCHD5 pAb (ATL-HPA038263)

Atlas Antibodies

SKU:
ATL-HPA038263-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in subsets of cells in seminiferus ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil-helix-coiled-coil-helix domain containing 5
Gene Name: CHCHD5
Alternative Gene Name: C2orf9, MGC11104, MIC14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037938: 90%, ENSRNOG00000018491: 92%
Entrez Gene ID: 84269
Uniprot ID: Q9BSY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MQAALEVTARYCGRELEQYGQCVAAKPESWQRDCHYLKMSIAQCTSSHPIIRQIRQACAQPFEAFEECLRQNEAAVGNCAEHMRRFLQCAEQVQPPRSPAT
Gene Sequence MQAALEVTARYCGRELEQYGQCVAAKPESWQRDCHYLKMSIAQCTSSHPIIRQIRQACAQPFEAFEECLRQNEAAVGNCAEHMRRFLQCAEQVQPPRSPAT
Gene ID - Mouse ENSMUSG00000037938
Gene ID - Rat ENSRNOG00000018491
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CHCHD5 pAb (ATL-HPA038263)
Datasheet Anti CHCHD5 pAb (ATL-HPA038263) Datasheet (External Link)
Vendor Page Anti CHCHD5 pAb (ATL-HPA038263) at Atlas Antibodies

Documents & Links for Anti CHCHD5 pAb (ATL-HPA038263)
Datasheet Anti CHCHD5 pAb (ATL-HPA038263) Datasheet (External Link)
Vendor Page Anti CHCHD5 pAb (ATL-HPA038263)