Anti CHCHD4 pAb (ATL-HPA034688)
Atlas Antibodies
- Catalog No.:
- ATL-HPA034688-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CHCHD4
Alternative Gene Name: FLJ31709, MIA40, TIMM40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034203: 96%, ENSRNOG00000033038: 96%
Entrez Gene ID: 131474
Uniprot ID: Q8N4Q1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDL |
| Gene Sequence | ELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDL |
| Gene ID - Mouse | ENSMUSG00000034203 |
| Gene ID - Rat | ENSRNOG00000033038 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CHCHD4 pAb (ATL-HPA034688) | |
| Datasheet | Anti CHCHD4 pAb (ATL-HPA034688) Datasheet (External Link) |
| Vendor Page | Anti CHCHD4 pAb (ATL-HPA034688) at Atlas Antibodies |
| Documents & Links for Anti CHCHD4 pAb (ATL-HPA034688) | |
| Datasheet | Anti CHCHD4 pAb (ATL-HPA034688) Datasheet (External Link) |
| Vendor Page | Anti CHCHD4 pAb (ATL-HPA034688) |
| Citations for Anti CHCHD4 pAb (ATL-HPA034688) – 4 Found |
| Erdogan, Alican J; Ali, Muna; Habich, Markus; Salscheider, Silja L; Schu, Laura; Petrungaro, Carmelina; Thomas, Luke W; Ashcroft, Margaret; Leichert, Lars I; Roma, Leticia Prates; Riemer, Jan. The mitochondrial oxidoreductase CHCHD4 is present in a semi-oxidized state in vivo. Redox Biology. 2018;17( 29704824):200-206. PubMed |
| Briston, Thomas; Stephen, Jenna M; Thomas, Luke W; Esposito, Cinzia; Chung, Yuen-Li; Syafruddin, Saiful E; Turmaine, Mark; Maddalena, Lucas A; Greef, Basma; Szabadkai, Gyorgy; Maxwell, Patrick H; Vanharanta, Sakari; Ashcroft, Margaret. VHL-Mediated Regulation of CHCHD4 and Mitochondrial Function. Frontiers In Oncology. 8( 30338240):388. PubMed |
| Thomas, Luke W; Esposito, Cinzia; Stephen, Jenna M; Costa, Ana S H; Frezza, Christian; Blacker, Thomas S; Szabadkai, Gyorgy; Ashcroft, Margaret. CHCHD4 regulates tumour proliferation and EMT-related phenotypes, through respiratory chain-mediated metabolism. Cancer & Metabolism. 7( 31346464):7. PubMed |
| Rao, Shuan; Mondragón, Laura; Pranjic, Blanka; Hanada, Toshikatsu; Stoll, Gautier; Köcher, Thomas; Zhang, Peng; Jais, Alexander; Lercher, Alexander; Bergthaler, Andreas; Schramek, Daniel; Haigh, Katharina; Sica, Valentina; Leduc, Marion; Modjtahedi, Nazanine; Pai, Tsung-Pin; Onji, Masahiro; Uribesalgo, Iris; Hanada, Reiko; Kozieradzki, Ivona; Koglgruber, Rubina; Cronin, Shane J; She, Zhigang; Quehenberger, Franz; Popper, Helmut; Kenner, Lukas; Haigh, Jody J; Kepp, Oliver; Rak, Malgorzata; Cai, Kaican; Kroemer, Guido; Penninger, Josef M. AIF-regulated oxidative phosphorylation supports lung cancer development. Cell Research. 2019;29(7):579-591. PubMed |