Anti CHCHD3 pAb (ATL-HPA042935 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA042935-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: coiled-coil-helix-coiled-coil-helix domain containing 3
Gene Name: CHCHD3
Alternative Gene Name: FLJ20420, MINOS3, PPP1R22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053768: 92%, ENSRNOG00000013211: 91%
Entrez Gene ID: 54927
Uniprot ID: Q9NX63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen DENENITVVKGIRLSENVIDRMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKRLKQAK
Gene Sequence DENENITVVKGIRLSENVIDRMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKRLKQAK
Gene ID - Mouse ENSMUSG00000053768
Gene ID - Rat ENSRNOG00000013211
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHCHD3 pAb (ATL-HPA042935 w/enhanced validation)
Datasheet Anti CHCHD3 pAb (ATL-HPA042935 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CHCHD3 pAb (ATL-HPA042935 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CHCHD3 pAb (ATL-HPA042935 w/enhanced validation)
Datasheet Anti CHCHD3 pAb (ATL-HPA042935 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CHCHD3 pAb (ATL-HPA042935 w/enhanced validation)
Citations for Anti CHCHD3 pAb (ATL-HPA042935 w/enhanced validation) – 4 Found
Wrobel, Lidia; Sokol, Anna M; Chojnacka, Magdalena; Chacinska, Agnieszka. The presence of disulfide bonds reveals an evolutionarily conserved mechanism involved in mitochondrial protein translocase assembly. Scientific Reports. 2016;6( 27265872):27484.  PubMed
Huang, Xiaoping; Wu, Beverly P; Nguyen, Diana; Liu, Yi-Ting; Marani, Melika; Hench, Jürgen; Bénit, Paule; Kozjak-Pavlovic, Vera; Rustin, Pierre; Frank, Stephan; Narendra, Derek P. CHCHD2 accumulates in distressed mitochondria and facilitates oligomerization of CHCHD10. Human Molecular Genetics. 2018;27(22):3881-3900.  PubMed
Liu, Yi-Ting; Huang, Xiaoping; Nguyen, Diana; Shammas, Mario K; Wu, Beverly P; Dombi, Eszter; Springer, Danielle A; Poulton, Joanna; Sekine, Shiori; Narendra, Derek P. Loss of CHCHD2 and CHCHD10 activates OMA1 peptidase to disrupt mitochondrial cristae phenocopying patient mutations. Human Molecular Genetics. 2020;29(9):1547-1567.  PubMed
Lobo, Miguel J; Reverte-Salisa, Laia; Chao, Ying-Chi; Koschinski, Andreas; Gesellchen, Frank; Subramaniam, Gunasekaran; Jiang, He; Pace, Samuel; Larcom, Natasha; Paolocci, Ester; Pfeifer, Alexander; Zanivan, Sara; Zaccolo, Manuela. Phosphodiesterase 2A2 regulates mitochondria clearance through Parkin-dependent mitophagy. Communications Biology. 2020;3(1):596.  PubMed