Anti CHCHD2 pAb (ATL-HPA027407 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA027407-25

• 
• 
• 

Protein Description: coiled-coil-helix-coiled-coil-helix domain containing 2
Gene Name: CHCHD2
Alternative Gene Name: C7orf17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034173: 70%, ENSRNOG00000000918: 70%
Entrez Gene ID: 51142
Uniprot ID: Q9Y6H1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YQQHQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANR
• Gene Sequence: YQQHQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANR
• Gene ID - Mouse: ENSMUSG00000034173
• Gene ID - Rat: ENSRNOG00000000918
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CHCHD2 pAb (ATL-HPA027407 w/enhanced validation) – 6 Found

Zhu, Lili; Gomez-Duran, Aurora; Saretzki, Gabriele; Jin, Shibo; Tilgner, Katarzyna; Melguizo-Sanchis, Dario; Anyfantis, Georgios; Al-Aama, Jumana; Vallier, Ludovic; Chinnery, Patrick; Lako, Majlinda; Armstrong, Lyle. The mitochondrial protein CHCHD2 primes the differentiation potential of human induced pluripotent stem cells to neuroectodermal lineages. The Journal Of Cell Biology. 2016;215(2):187-202. 

Straub, Isabella R; Janer, Alexandre; Weraarpachai, Woranontee; Zinman, Lorne; Robertson, Janice; Rogaeva, Ekaterina; Shoubridge, Eric A. Loss of CHCHD10-CHCHD2 complexes required for respiration underlies the pathogenicity of a CHCHD10 mutation in ALS. Human Molecular Genetics. 2018;27(1):178-189. 

Zhou, Wei; Ma, Dongrui; Sun, Alfred Xuyang; Tran, Hoang-Dai; Ma, Dong-Liang; Singh, Brijesh K; Zhou, Jin; Zhang, Jinyan; Wang, Danlei; Zhao, Yi; Yen, Paul M; Goh, Eyleen; Tan, Eng-King. PD-linked CHCHD2 mutations impair CHCHD10 and MICOS complex leading to mitochondria dysfunction. Human Molecular Genetics. 2019;28(7):1100-1116. 

Huang, Xiaoping; Wu, Beverly P; Nguyen, Diana; Liu, Yi-Ting; Marani, Melika; Hench, Jürgen; Bénit, Paule; Kozjak-Pavlovic, Vera; Rustin, Pierre; Frank, Stephan; Narendra, Derek P. CHCHD2 accumulates in distressed mitochondria and facilitates oligomerization of CHCHD10. Human Molecular Genetics. 2018;27(22):3881-3900. 

Liu, Yi-Ting; Huang, Xiaoping; Nguyen, Diana; Shammas, Mario K; Wu, Beverly P; Dombi, Eszter; Springer, Danielle A; Poulton, Joanna; Sekine, Shiori; Narendra, Derek P. Loss of CHCHD2 and CHCHD10 activates OMA1 peptidase to disrupt mitochondrial cristae phenocopying patient mutations. Human Molecular Genetics. 2020;29(9):1547-1567. 

Li, Yue; Xiu, Wenjing; Xu, Jingwen; Chen, Xiangmei; Wang, Guangyan; Duan, Jinjie; Sun, Lei; Liu, Ben; Xie, Wen; Pu, Guangyin; Wang, Qi; Wang, Chunjiong. Increased CHCHD2 expression promotes liver fibrosis in nonalcoholic steatohepatitis via Notch/osteopontin signaling. Jci Insight. 2022;7(23)