Anti CHCHD10 pAb (ATL-HPA003440 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA003440-25

• 
• 
• 

Protein Description: coiled-coil-helix-coiled-coil-helix domain containing 10
Gene Name: CHCHD10
Alternative Gene Name: C22orf16, N27C7-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049422: 87%, ENSRNOG00000053231: 89%
Entrez Gene ID: 400916
Uniprot ID: Q8WYQ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP
• Gene Sequence: GLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP
• Gene ID - Mouse: ENSMUSG00000049422
• Gene ID - Rat: ENSRNOG00000053231
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CHCHD10 pAb (ATL-HPA003440 w/enhanced validation) – 8 Found

Bannwarth, Sylvie; Ait-El-Mkadem, Samira; Chaussenot, Annabelle; Genin, Emmanuelle C; Lacas-Gervais, Sandra; Fragaki, Konstantina; Berg-Alonso, Laetitia; Kageyama, Yusuke; Serre, Valérie; Moore, David G; Verschueren, Annie; Rouzier, Cécile; Le Ber, Isabelle; Augé, Gaëlle; Cochaud, Charlotte; Lespinasse, Françoise; N'Guyen, Karine; de Septenville, Anne; Brice, Alexis; Yu-Wai-Man, Patrick; Sesaki, Hiromi; Pouget, Jean; Paquis-Flucklinger, Véronique. A mitochondrial origin for frontotemporal dementia and amyotrophic lateral sclerosis through CHCHD10 involvement. Brain : A Journal Of Neurology. 2014;137(Pt 8):2329-45. 

Burstein, S R; Valsecchi, F; Kawamata, H; Bourens, M; Zeng, R; Zuberi, A; Milner, T A; Cloonan, S M; Lutz, C; Barrientos, A; Manfredi, G. In vitro and in vivo studies of the ALS-FTLD protein CHCHD10 reveal novel mitochondrial topology and protein interactions. Human Molecular Genetics. 2018;27(1):160-177. 

Straub, Isabella R; Janer, Alexandre; Weraarpachai, Woranontee; Zinman, Lorne; Robertson, Janice; Rogaeva, Ekaterina; Shoubridge, Eric A. Loss of CHCHD10-CHCHD2 complexes required for respiration underlies the pathogenicity of a CHCHD10 mutation in ALS. Human Molecular Genetics. 2018;27(1):178-189. 

Purandare, Neeraja; Somayajulu, Mallika; Hüttemann, Maik; Grossman, Lawrence I; Aras, Siddhesh. The cellular stress proteins CHCHD10 and MNRR1 (CHCHD2): Partners in mitochondrial and nuclear function and dysfunction. The Journal Of Biological Chemistry. 2018;293(17):6517-6529. 

Houston, Ryan; Sekine, Yusuke; Larsen, Mads B; Murakami, Kei; Mullett, Steven J; Wendell, Stacy G; Narendra, Derek P; Chen, Bill B; Sekine, Shiori. Discovery of bactericides as an acute mitochondrial membrane damage inducer. Molecular Biology Of The Cell. 2021;32(21):ar32. 

Huang, Xiaoping; Wu, Beverly P; Nguyen, Diana; Liu, Yi-Ting; Marani, Melika; Hench, Jürgen; Bénit, Paule; Kozjak-Pavlovic, Vera; Rustin, Pierre; Frank, Stephan; Narendra, Derek P. CHCHD2 accumulates in distressed mitochondria and facilitates oligomerization of CHCHD10. Human Molecular Genetics. 2018;27(22):3881-3900. 

Liu, Yi-Ting; Huang, Xiaoping; Nguyen, Diana; Shammas, Mario K; Wu, Beverly P; Dombi, Eszter; Springer, Danielle A; Poulton, Joanna; Sekine, Shiori; Narendra, Derek P. Loss of CHCHD2 and CHCHD10 activates OMA1 peptidase to disrupt mitochondrial cristae phenocopying patient mutations. Human Molecular Genetics. 2020;29(9):1547-1567. 

Neupane, Nirajan; Rajendran, Jayasimman; Kvist, Jouni; Harjuhaahto, Sandra; Hu, Bowen; Kinnunen, Veijo; Yang, Yang; Nieminen, Anni I; Tyynismaa, Henna. Inter-organellar and systemic responses to impaired mitochondrial matrix protein import in skeletal muscle. Communications Biology. 2022;5(1):1060.