Anti CHCHD1 pAb (ATL-HPA039046)

Atlas Antibodies

SKU: ATL-HPA039046-25

• 
• 
• 

Protein Description: coiled-coil-helix-coiled-coil-helix domain containing 1
Gene Name: CHCHD1
Alternative Gene Name: C10orf34, FLJ25854
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063787: 92%, ENSRNOG00000009297: 92%
Entrez Gene ID: 118487
Uniprot ID: Q96BP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQN
• Gene Sequence: MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQN
• Gene ID - Mouse: ENSMUSG00000063787
• Gene ID - Rat: ENSRNOG00000009297
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.