Anti CHAT pAb (ATL-HPA048547)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048547-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CHAT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021919: 96%, ENSRNOG00000025012: 96%
Entrez Gene ID: 1103
Uniprot ID: P28329
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTN |
| Gene Sequence | GLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTN |
| Gene ID - Mouse | ENSMUSG00000021919 |
| Gene ID - Rat | ENSRNOG00000025012 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CHAT pAb (ATL-HPA048547) | |
| Datasheet | Anti CHAT pAb (ATL-HPA048547) Datasheet (External Link) |
| Vendor Page | Anti CHAT pAb (ATL-HPA048547) at Atlas Antibodies |
| Documents & Links for Anti CHAT pAb (ATL-HPA048547) | |
| Datasheet | Anti CHAT pAb (ATL-HPA048547) Datasheet (External Link) |
| Vendor Page | Anti CHAT pAb (ATL-HPA048547) |
| Citations for Anti CHAT pAb (ATL-HPA048547) – 2 Found |
| Haidar, Mansour; Asselbergh, Bob; Adriaenssens, Elias; De Winter, Vicky; Timmermans, Jean-Pierre; Auer-Grumbach, Michaela; Juneja, Manisha; Timmerman, Vincent. Neuropathy-causing mutations in HSPB1 impair autophagy by disturbing the formation of SQSTM1/p62 bodies. Autophagy. 2019;15(6):1051-1068. PubMed |
| Hatton, Christopher; Reeve, Amy; Lax, Nichola Zoe; Blain, Alasdair; Ng, Yi Shiau; El-Agnaf, Omar; Attems, Johannes; Taylor, John-Paul; Turnbull, Doug; Erskine, Daniel. Complex I reductions in the nucleus basalis of Meynert in Lewy body dementia: the role of Lewy bodies. Acta Neuropathologica Communications. 2020;8(1):103. PubMed |