Anti CHAMP1 pAb (ATL-HPA008900 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA008900-25

• 
• 

Protein Description: chromosome alignment maintaining phosphoprotein 1
Gene Name: CHAMP1
Alternative Gene Name: C13orf8, CAMP, CHAMP, ZNF828
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047710: 71%, ENSRNOG00000000112: 71%
Entrez Gene ID: 283489
Uniprot ID: Q96JM3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IWKPVLSIDTEPRKPALFPEPAKTAPPASPEARKRALFPEPRKHALFPELPKSALFSESQKAVELGDELQIDAIDDQKCDILVQEELLASPKKLLEDTLFPSSKKLKKDNQESSDAELSSSEYIKTDLDAMDI
• Gene Sequence: IWKPVLSIDTEPRKPALFPEPAKTAPPASPEARKRALFPEPRKHALFPELPKSALFSESQKAVELGDELQIDAIDDQKCDILVQEELLASPKKLLEDTLFPSSKKLKKDNQESSDAELSSSEYIKTDLDAMDI
• Gene ID - Mouse: ENSMUSG00000047710
• Gene ID - Rat: ENSRNOG00000000112
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CHAMP1 pAb (ATL-HPA008900 w/enhanced validation) – 2 Found

Hara, Kodai; Taharazako, Shota; Ikeda, Masanori; Fujita, Hiroki; Mikami, Yoshiko; Kikuchi, Sotaro; Hishiki, Asami; Yokoyama, Hideshi; Ishikawa, Yoshinobu; Kanno, Shin-Ichiro; Tanaka, Kozo; Hashimoto, Hiroshi. Dynamic feature of mitotic arrest deficient 2-like protein 2 (MAD2L2) and structural basis for its interaction with chromosome alignment-maintaining phosphoprotein (CAMP). The Journal Of Biological Chemistry. 2017;292(43):17658-17667. 

Hino, Maho; Iemura, Kenji; Ikeda, Masanori; Itoh, Go; Tanaka, Kozo. Chromosome alignment-maintaining phosphoprotein CHAMP1 plays a role in cell survival through regulating Mcl-1 expression. Cancer Science. 2021;112(9):3711-3721.