Anti CHAMP1 pAb (ATL-HPA006623 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA006623-25
  • Immunohistochemical staining of human colon, kidney, lymph node and testis using Anti-CHAMP1 antibody HPA006623 (A) shows similar protein distribution across tissues to independent antibody HPA008900 (B).
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & midbody ring.
  • Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CHAMP1 antibody. Remaining relative intensity is presented.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome alignment maintaining phosphoprotein 1
Gene Name: CHAMP1
Alternative Gene Name: C13orf8, CAMP, CHAMP, ZNF828
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047710: 47%, ENSRNOG00000000112: 51%
Entrez Gene ID: 283489
Uniprot ID: Q96JM3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YYHITSKHASPDKWNDKPKNQLNKETDPVKSPPLPEHQKIPCNSAEPKSIPALSMETQKLGSVLSPESPKPTPLTPLEPQKPGSVVSPELQTPLPSPEPSKPASVSSPEPP
Gene Sequence YYHITSKHASPDKWNDKPKNQLNKETDPVKSPPLPEHQKIPCNSAEPKSIPALSMETQKLGSVLSPESPKPTPLTPLEPQKPGSVVSPELQTPLPSPEPSKPASVSSPEPP
Gene ID - Mouse ENSMUSG00000047710
Gene ID - Rat ENSRNOG00000000112
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CHAMP1 pAb (ATL-HPA006623 w/enhanced validation)
Datasheet Anti CHAMP1 pAb (ATL-HPA006623 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CHAMP1 pAb (ATL-HPA006623 w/enhanced validation)