Anti CHAF1B pAb (ATL-HPA021679)

Atlas Antibodies

SKU: ATL-HPA021679-25

• 
• 
• 

Protein Description: chromatin assembly factor 1, subunit B (p60)
Gene Name: CHAF1B
Alternative Gene Name: CAF-1, CAF1, CAF1A, CAF1P60, MPHOSPH7, MPP7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022945: 67%, ENSRNOG00000001692: 65%
Entrez Gene ID: 8208
Uniprot ID: Q13112
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PAPTVIRDPPSITPAVKSPLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQAWSKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKG
• Gene Sequence: PAPTVIRDPPSITPAVKSPLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQAWSKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKG
• Gene ID - Mouse: ENSMUSG00000022945
• Gene ID - Rat: ENSRNOG00000001692
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CHAF1B pAb (ATL-HPA021679) – 3 Found

Gomes, Ana P; Ilter, Didem; Low, Vivien; Rosenzweig, Adam; Shen, Zih-Jie; Schild, Tanya; Rivas, Martin A; Er, Ekrem E; McNally, Dylan R; Mutvei, Anders P; Han, Julie; Ou, Yi-Hung; Cavaliere, Paola; Mullarky, Edouard; Nagiec, Michal; Shin, Sejeong; Yoon, Sang-Oh; Dephoure, Noah; Massagué, Joan; Melnick, Ari M; Cantley, Lewis C; Tyler, Jessica K; Blenis, John. Dynamic Incorporation of Histone H3 Variants into Chromatin Is Essential for Acquisition of Aggressive Traits and Metastatic Colonization. Cancer Cell. 2019;36(4):402-417.e13. 

Morra, Francesco; Merolla, Francesco; Picardi, Ida; Russo, Daniela; Ilardi, Gennaro; Varricchio, Silvia; Liotti, Federica; Pacelli, Roberto; Palazzo, Luca; Mascolo, Massimo; Celetti, Angela; Staibano, Stefania. CAF-1 Subunits Levels Suggest Combined Treatments with PARP-Inhibitors and Ionizing Radiation in Advanced HNSCC. Cancers. 2019;11(10) 

Ilter, Didem; Drapela, Stanislav; Schild, Tanya; Ward, Nathan P; Adhikari, Emma; Low, Vivien; Asara, John; Oskarsson, Thordur; Lau, Eric K; DeNicola, Gina M; McReynolds, Melanie R; Gomes, Ana P. NADK-mediated de novo NADP(H) synthesis is a metabolic adaptation essential for breast cancer metastasis. Redox Biology. 2023;61( 36841051):102627.