Anti CHADL pAb (ATL-HPA024654)

Atlas Antibodies

Catalog No.:
ATL-HPA024654-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chondroadherin-like
Gene Name: CHADL
Alternative Gene Name: SLRR4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063765: 85%, ENSRNOG00000024631: 85%
Entrez Gene ID: 150356
Uniprot ID: Q6NUI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QRCPQACICDNSRRHVACRYQNLTEVPDAIPELTQRLDLQGNLLKVIPAAAFQ
Gene Sequence QRCPQACICDNSRRHVACRYQNLTEVPDAIPELTQRLDLQGNLLKVIPAAAFQ
Gene ID - Mouse ENSMUSG00000063765
Gene ID - Rat ENSRNOG00000024631
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHADL pAb (ATL-HPA024654)
Datasheet Anti CHADL pAb (ATL-HPA024654) Datasheet (External Link)
Vendor Page Anti CHADL pAb (ATL-HPA024654) at Atlas Antibodies

Documents & Links for Anti CHADL pAb (ATL-HPA024654)
Datasheet Anti CHADL pAb (ATL-HPA024654) Datasheet (External Link)
Vendor Page Anti CHADL pAb (ATL-HPA024654)