Anti CHAC2 pAb (ATL-HPA049235)

Atlas Antibodies

SKU:
ATL-HPA049235-25
  • Immunohistochemical staining of human esophagus shows distinct cytoplasmic and membranous positivity in superficial squamous epithelial cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ChaC, cation transport regulator homolog 2 (E. coli)
Gene Name: CHAC2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020309: 86%, ENSRNOG00000001531: 88%
Entrez Gene ID: 494143
Uniprot ID: Q8WUX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGPAPLEDIAEQIFNAAGPSGRNTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLN
Gene Sequence LGPAPLEDIAEQIFNAAGPSGRNTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLN
Gene ID - Mouse ENSMUSG00000020309
Gene ID - Rat ENSRNOG00000001531
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CHAC2 pAb (ATL-HPA049235)
Datasheet Anti CHAC2 pAb (ATL-HPA049235) Datasheet (External Link)
Vendor Page Anti CHAC2 pAb (ATL-HPA049235) at Atlas Antibodies

Documents & Links for Anti CHAC2 pAb (ATL-HPA049235)
Datasheet Anti CHAC2 pAb (ATL-HPA049235) Datasheet (External Link)
Vendor Page Anti CHAC2 pAb (ATL-HPA049235)