Anti CHAC1 pAb (ATL-HPA043505)

Atlas Antibodies

Catalog No.:
ATL-HPA043505-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ChaC, cation transport regulator homolog 1 (E. coli)
Gene Name: CHAC1
Alternative Gene Name: MGC4504
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027313: 91%, ENSRNOG00000014387: 94%
Entrez Gene ID: 79094
Uniprot ID: Q9BUX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGY
Gene Sequence TLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGY
Gene ID - Mouse ENSMUSG00000027313
Gene ID - Rat ENSRNOG00000014387
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHAC1 pAb (ATL-HPA043505)
Datasheet Anti CHAC1 pAb (ATL-HPA043505) Datasheet (External Link)
Vendor Page Anti CHAC1 pAb (ATL-HPA043505) at Atlas Antibodies

Documents & Links for Anti CHAC1 pAb (ATL-HPA043505)
Datasheet Anti CHAC1 pAb (ATL-HPA043505) Datasheet (External Link)
Vendor Page Anti CHAC1 pAb (ATL-HPA043505)
Citations for Anti CHAC1 pAb (ATL-HPA043505) – 1 Found
He, Saifei; Zhang, Miao; Ye, Ying; Zhuang, Juhua; Ma, Xing; Song, Yanan; Xia, Wei. ChaC glutathione specific γ-glutamylcyclotransferase 1 inhibits cell viability and increases the sensitivity of prostate cancer cells to docetaxel by inducing endoplasmic reticulum stress and ferroptosis. Experimental And Therapeutic Medicine. 2021;22(3):997.  PubMed