Anti CHAC1 pAb (ATL-HPA043505)
Atlas Antibodies
- SKU:
- ATL-HPA043505-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CHAC1
Alternative Gene Name: MGC4504
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027313: 91%, ENSRNOG00000014387: 94%
Entrez Gene ID: 79094
Uniprot ID: Q9BUX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGY |
| Gene Sequence | TLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGY |
| Gene ID - Mouse | ENSMUSG00000027313 |
| Gene ID - Rat | ENSRNOG00000014387 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CHAC1 pAb (ATL-HPA043505) | |
| Datasheet | Anti CHAC1 pAb (ATL-HPA043505) Datasheet (External Link) |
| Vendor Page | Anti CHAC1 pAb (ATL-HPA043505) at Atlas Antibodies |
| Documents & Links for Anti CHAC1 pAb (ATL-HPA043505) | |
| Datasheet | Anti CHAC1 pAb (ATL-HPA043505) Datasheet (External Link) |
| Vendor Page | Anti CHAC1 pAb (ATL-HPA043505) |
| Citations for Anti CHAC1 pAb (ATL-HPA043505) – 1 Found |
| He, Saifei; Zhang, Miao; Ye, Ying; Zhuang, Juhua; Ma, Xing; Song, Yanan; Xia, Wei. ChaC glutathione specific γ-glutamylcyclotransferase 1 inhibits cell viability and increases the sensitivity of prostate cancer cells to docetaxel by inducing endoplasmic reticulum stress and ferroptosis. Experimental And Therapeutic Medicine. 2021;22(3):997. PubMed |