Anti CGRRF1 pAb (ATL-HPA002930)

Atlas Antibodies

SKU: ATL-HPA002930-25

• 
• 
• 

Protein Description: cell growth regulator with ring finger domain 1
Gene Name: CGRRF1
Alternative Gene Name: CGR19, RNF197
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055128: 76%, ENSRNOG00000010178: 76%
Entrez Gene ID: 10668
Uniprot ID: Q99675
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IYDIISMVSVIHIPDRTYKLSCRILYQYLLLAQGQFHDLKQLFMSANNNFTPSNNSSSEEKNTDRSLLEKVGLSESEVEPSEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALCSQKEQDKDKPK
• Gene Sequence: IYDIISMVSVIHIPDRTYKLSCRILYQYLLLAQGQFHDLKQLFMSANNNFTPSNNSSSEEKNTDRSLLEKVGLSESEVEPSEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALCSQKEQDKDKPK
• Gene ID - Mouse: ENSMUSG00000055128
• Gene ID - Rat: ENSRNOG00000010178
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CGRRF1 pAb (ATL-HPA002930) – 2 Found

Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. 

Lee, Yu-Ju; Ho, Shiuh-Rong; Graves, Joshua D; Xiao, Yang; Huang, Shixia; Lin, Weei-Chin. CGRRF1, a growth suppressor, regulates EGFR ubiquitination in breast cancer. Breast Cancer Research : Bcr. 2019;21(1):134.