Anti CGRRF1 pAb (ATL-HPA002930)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002930-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CGRRF1
Alternative Gene Name: CGR19, RNF197
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055128: 76%, ENSRNOG00000010178: 76%
Entrez Gene ID: 10668
Uniprot ID: Q99675
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IYDIISMVSVIHIPDRTYKLSCRILYQYLLLAQGQFHDLKQLFMSANNNFTPSNNSSSEEKNTDRSLLEKVGLSESEVEPSEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALCSQKEQDKDKPK |
| Gene Sequence | IYDIISMVSVIHIPDRTYKLSCRILYQYLLLAQGQFHDLKQLFMSANNNFTPSNNSSSEEKNTDRSLLEKVGLSESEVEPSEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALCSQKEQDKDKPK |
| Gene ID - Mouse | ENSMUSG00000055128 |
| Gene ID - Rat | ENSRNOG00000010178 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CGRRF1 pAb (ATL-HPA002930) | |
| Datasheet | Anti CGRRF1 pAb (ATL-HPA002930) Datasheet (External Link) |
| Vendor Page | Anti CGRRF1 pAb (ATL-HPA002930) at Atlas Antibodies |
| Documents & Links for Anti CGRRF1 pAb (ATL-HPA002930) | |
| Datasheet | Anti CGRRF1 pAb (ATL-HPA002930) Datasheet (External Link) |
| Vendor Page | Anti CGRRF1 pAb (ATL-HPA002930) |
| Citations for Anti CGRRF1 pAb (ATL-HPA002930) – 2 Found |
| Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. PubMed |
| Lee, Yu-Ju; Ho, Shiuh-Rong; Graves, Joshua D; Xiao, Yang; Huang, Shixia; Lin, Weei-Chin. CGRRF1, a growth suppressor, regulates EGFR ubiquitination in breast cancer. Breast Cancer Research : Bcr. 2019;21(1):134. PubMed |