Anti CGNL1 pAb (ATL-HPA056911 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA056911-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cingulin-like 1
Gene Name: CGNL1
Alternative Gene Name: FLJ14957, JACOP, KIAA1749, paracingulin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032232: 91%, ENSRNOG00000054080: 89%
Entrez Gene ID: 84952
Uniprot ID: Q0VF96
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NEKVEENSTLQQRLEESEGELRKNLEELFQVKMEREQHQTEIRDLQDQLSEMHDELDSAKRSEDREKGALIEELLQAKQDLQDLLIAK
Gene Sequence NEKVEENSTLQQRLEESEGELRKNLEELFQVKMEREQHQTEIRDLQDQLSEMHDELDSAKRSEDREKGALIEELLQAKQDLQDLLIAK
Gene ID - Mouse ENSMUSG00000032232
Gene ID - Rat ENSRNOG00000054080
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CGNL1 pAb (ATL-HPA056911 w/enhanced validation)
Datasheet Anti CGNL1 pAb (ATL-HPA056911 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CGNL1 pAb (ATL-HPA056911 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CGNL1 pAb (ATL-HPA056911 w/enhanced validation)
Datasheet Anti CGNL1 pAb (ATL-HPA056911 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CGNL1 pAb (ATL-HPA056911 w/enhanced validation)