Anti CGN pAb (ATL-HPA027657 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027657-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CGN
Alternative Gene Name: KIAA1319
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068876: 92%, ENSRNOG00000020952: 92%
Entrez Gene ID: 57530
Uniprot ID: Q9P2M7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DSKQALQQLQAQLEDYKEKARREVADAQRQAKDWASEAEKTSGGLSRLQDEIQRLRQALQASQAERDTARLDKELLAQRLQGLEQEAENKKRSQDDRARQLKGLEE |
| Gene Sequence | DSKQALQQLQAQLEDYKEKARREVADAQRQAKDWASEAEKTSGGLSRLQDEIQRLRQALQASQAERDTARLDKELLAQRLQGLEQEAENKKRSQDDRARQLKGLEE |
| Gene ID - Mouse | ENSMUSG00000068876 |
| Gene ID - Rat | ENSRNOG00000020952 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CGN pAb (ATL-HPA027657 w/enhanced validation) | |
| Datasheet | Anti CGN pAb (ATL-HPA027657 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CGN pAb (ATL-HPA027657 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CGN pAb (ATL-HPA027657 w/enhanced validation) | |
| Datasheet | Anti CGN pAb (ATL-HPA027657 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CGN pAb (ATL-HPA027657 w/enhanced validation) |
| Citations for Anti CGN pAb (ATL-HPA027657 w/enhanced validation) – 2 Found |
| De Marchi, Tommaso; Liu, Ning Qing; Stingl, Cristoph; Timmermans, Mieke A; Smid, Marcel; Look, Maxime P; Tjoa, Mila; Braakman, Rene B H; Opdam, Mark; Linn, Sabine C; Sweep, Fred C G J; Span, Paul N; Kliffen, Mike; Luider, Theo M; Foekens, John A; Martens, John W M; Umar, Arzu. 4-protein signature predicting tamoxifen treatment outcome in recurrent breast cancer. Molecular Oncology. 2016;10(1):24-39. PubMed |
| Holzner, Silvio; Bromberger, Sophie; Wenzina, Judith; Neumüller, Karin; Holper, Tina-Maria; Petzelbauer, Peter; Bauer, Wolfgang; Weber, Benedikt; Schossleitner, Klaudia. Phosphorylated cingulin localises GEF-H1 at tight junctions to protect vascular barriers in blood endothelial cells. Journal Of Cell Science. 2021;134(17) PubMed |