Anti CGN pAb (ATL-HPA027657 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA027657-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cingulin
Gene Name: CGN
Alternative Gene Name: KIAA1319
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068876: 92%, ENSRNOG00000020952: 92%
Entrez Gene ID: 57530
Uniprot ID: Q9P2M7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Rat
Clonality Polyclonal
Host Rabbit
Immunogen DSKQALQQLQAQLEDYKEKARREVADAQRQAKDWASEAEKTSGGLSRLQDEIQRLRQALQASQAERDTARLDKELLAQRLQGLEQEAENKKRSQDDRARQLKGLEE
Gene Sequence DSKQALQQLQAQLEDYKEKARREVADAQRQAKDWASEAEKTSGGLSRLQDEIQRLRQALQASQAERDTARLDKELLAQRLQGLEQEAENKKRSQDDRARQLKGLEE
Gene ID - Mouse ENSMUSG00000068876
Gene ID - Rat ENSRNOG00000020952
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CGN pAb (ATL-HPA027657 w/enhanced validation)
Datasheet Anti CGN pAb (ATL-HPA027657 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CGN pAb (ATL-HPA027657 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CGN pAb (ATL-HPA027657 w/enhanced validation)
Datasheet Anti CGN pAb (ATL-HPA027657 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CGN pAb (ATL-HPA027657 w/enhanced validation)
Citations for Anti CGN pAb (ATL-HPA027657 w/enhanced validation) – 2 Found
De Marchi, Tommaso; Liu, Ning Qing; Stingl, Cristoph; Timmermans, Mieke A; Smid, Marcel; Look, Maxime P; Tjoa, Mila; Braakman, Rene B H; Opdam, Mark; Linn, Sabine C; Sweep, Fred C G J; Span, Paul N; Kliffen, Mike; Luider, Theo M; Foekens, John A; Martens, John W M; Umar, Arzu. 4-protein signature predicting tamoxifen treatment outcome in recurrent breast cancer. Molecular Oncology. 2016;10(1):24-39.  PubMed
Holzner, Silvio; Bromberger, Sophie; Wenzina, Judith; Neumüller, Karin; Holper, Tina-Maria; Petzelbauer, Peter; Bauer, Wolfgang; Weber, Benedikt; Schossleitner, Klaudia. Phosphorylated cingulin localises GEF-H1 at tight junctions to protect vascular barriers in blood endothelial cells. Journal Of Cell Science. 2021;134(17)  PubMed