Anti CGN pAb (ATL-HPA027587 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA027587-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cingulin
Gene Name: CGN
Alternative Gene Name: KIAA1319
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068876: 72%, ENSRNOG00000020952: 72%
Entrez Gene ID: 57530
Uniprot ID: Q9P2M7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGDSFGVQIKGANDQGASGALSSDLELPENPYSQVKGFPAPSQSSTSDEEPGAYWNGKLLRSHSQASLAGPGPVDPSNRSNSMLELAPKV
Gene Sequence GGDSFGVQIKGANDQGASGALSSDLELPENPYSQVKGFPAPSQSSTSDEEPGAYWNGKLLRSHSQASLAGPGPVDPSNRSNSMLELAPKV
Gene ID - Mouse ENSMUSG00000068876
Gene ID - Rat ENSRNOG00000020952
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CGN pAb (ATL-HPA027587 w/enhanced validation)
Datasheet Anti CGN pAb (ATL-HPA027587 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CGN pAb (ATL-HPA027587 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CGN pAb (ATL-HPA027587 w/enhanced validation)
Datasheet Anti CGN pAb (ATL-HPA027587 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CGN pAb (ATL-HPA027587 w/enhanced validation)
Citations for Anti CGN pAb (ATL-HPA027587 w/enhanced validation) – 1 Found
Oliveto, Stefania; Alfieri, Roberta; Miluzio, Annarita; Scagliola, Alessandra; Secli, Raissa S; Gasparini, Pierluigi; Grosso, Stefano; Cascione, Luciano; Mutti, Luciano; Biffo, Stefano. A Polysome-Based microRNA Screen Identifies miR-24-3p as a Novel Promigratory miRNA in Mesothelioma. Cancer Research. 2018;78(20):5741-5753.  PubMed