Anti CGN pAb (ATL-HPA027586 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027586-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CGN
Alternative Gene Name: KIAA1319
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068876: 87%, ENSRNOG00000020952: 83%
Entrez Gene ID: 57530
Uniprot ID: Q9P2M7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PPGSVDHMKATIYGILREGSSESETSVRRKVSLVLEKMQPLVMVSSGSTKAVAGQGELTRKVEELQRKLDEEVKKRQKLEPSQVGLERQLEEKTEECSRLQELLER |
Gene Sequence | PPGSVDHMKATIYGILREGSSESETSVRRKVSLVLEKMQPLVMVSSGSTKAVAGQGELTRKVEELQRKLDEEVKKRQKLEPSQVGLERQLEEKTEECSRLQELLER |
Gene ID - Mouse | ENSMUSG00000068876 |
Gene ID - Rat | ENSRNOG00000020952 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CGN pAb (ATL-HPA027586 w/enhanced validation) | |
Datasheet | Anti CGN pAb (ATL-HPA027586 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CGN pAb (ATL-HPA027586 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CGN pAb (ATL-HPA027586 w/enhanced validation) | |
Datasheet | Anti CGN pAb (ATL-HPA027586 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CGN pAb (ATL-HPA027586 w/enhanced validation) |
Citations for Anti CGN pAb (ATL-HPA027586 w/enhanced validation) – 1 Found |
Holzner, Silvio; Bromberger, Sophie; Wenzina, Judith; Neumüller, Karin; Holper, Tina-Maria; Petzelbauer, Peter; Bauer, Wolfgang; Weber, Benedikt; Schossleitner, Klaudia. Phosphorylated cingulin localises GEF-H1 at tight junctions to protect vascular barriers in blood endothelial cells. Journal Of Cell Science. 2021;134(17) PubMed |