Anti CGN pAb (ATL-HPA027586 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA027586-25
  • Immunohistochemistry analysis in human small intestine and lymph node tissues using Anti-CGN antibody. Corresponding CGN RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cell junctions.
  • Western blot analysis in human cell lines Caco-2 and HeLa using Anti-CGN antibody. Corresponding CGN RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cingulin
Gene Name: CGN
Alternative Gene Name: KIAA1319
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068876: 87%, ENSRNOG00000020952: 83%
Entrez Gene ID: 57530
Uniprot ID: Q9P2M7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPGSVDHMKATIYGILREGSSESETSVRRKVSLVLEKMQPLVMVSSGSTKAVAGQGELTRKVEELQRKLDEEVKKRQKLEPSQVGLERQLEEKTEECSRLQELLER
Gene Sequence PPGSVDHMKATIYGILREGSSESETSVRRKVSLVLEKMQPLVMVSSGSTKAVAGQGELTRKVEELQRKLDEEVKKRQKLEPSQVGLERQLEEKTEECSRLQELLER
Gene ID - Mouse ENSMUSG00000068876
Gene ID - Rat ENSRNOG00000020952
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CGN pAb (ATL-HPA027586 w/enhanced validation)
Datasheet Anti CGN pAb (ATL-HPA027586 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CGN pAb (ATL-HPA027586 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CGN pAb (ATL-HPA027586 w/enhanced validation)
Datasheet Anti CGN pAb (ATL-HPA027586 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CGN pAb (ATL-HPA027586 w/enhanced validation)



Citations for Anti CGN pAb (ATL-HPA027586 w/enhanced validation) – 1 Found
Holzner, Silvio; Bromberger, Sophie; Wenzina, Judith; Neumüller, Karin; Holper, Tina-Maria; Petzelbauer, Peter; Bauer, Wolfgang; Weber, Benedikt; Schossleitner, Klaudia. Phosphorylated cingulin localises GEF-H1 at tight junctions to protect vascular barriers in blood endothelial cells. Journal Of Cell Science. 2021;134(17)  PubMed
!