Anti CGGBP1 pAb (ATL-HPA037017 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA037017-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: CGG triplet repeat binding protein 1
Gene Name: CGGBP1
Alternative Gene Name: CGGBP, p20-CGGBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054604: 96%, ENSRNOG00000000718: 100%
Entrez Gene ID: 8545
Uniprot ID: Q9UFW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQD
Gene Sequence PLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQD
Gene ID - Mouse ENSMUSG00000054604
Gene ID - Rat ENSRNOG00000000718
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CGGBP1 pAb (ATL-HPA037017 w/enhanced validation)
Datasheet Anti CGGBP1 pAb (ATL-HPA037017 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CGGBP1 pAb (ATL-HPA037017 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CGGBP1 pAb (ATL-HPA037017 w/enhanced validation)
Datasheet Anti CGGBP1 pAb (ATL-HPA037017 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CGGBP1 pAb (ATL-HPA037017 w/enhanced validation)