Anti CGGBP1 pAb (ATL-HPA035568 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA035568-25

• 
• 
• 

Protein Description: CGG triplet repeat binding protein 1
Gene Name: CGGBP1
Alternative Gene Name: CGGBP, p20-CGGBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054604: 100%, ENSRNOG00000000718: 100%
Entrez Gene ID: 8545
Uniprot ID: Q9UFW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRK
• Gene Sequence: MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRK
• Gene ID - Mouse: ENSMUSG00000054604
• Gene ID - Rat: ENSRNOG00000000718
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CGGBP1 pAb (ATL-HPA035568 w/enhanced validation) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.