Anti CFTR pAb (ATL-HPA021939)

Atlas Antibodies

Catalog No.:
ATL-HPA021939-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7)
Gene Name: CFTR
Alternative Gene Name: ABC35, ABCC7, CF, CFTR/MRP, dJ760C5.1, MRP7, TNR-CFTR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041301: 61%, ENSRNOG00000055103: 59%
Entrez Gene ID: 1080
Uniprot ID: P13569
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen INSIRKFSIVQKTPLQMNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQSVLNLMTHSVNQGQNIHRKTTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEEDL
Gene Sequence INSIRKFSIVQKTPLQMNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQSVLNLMTHSVNQGQNIHRKTTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEEDL
Gene ID - Mouse ENSMUSG00000041301
Gene ID - Rat ENSRNOG00000055103
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CFTR pAb (ATL-HPA021939)
Datasheet Anti CFTR pAb (ATL-HPA021939) Datasheet (External Link)
Vendor Page Anti CFTR pAb (ATL-HPA021939) at Atlas Antibodies

Documents & Links for Anti CFTR pAb (ATL-HPA021939)
Datasheet Anti CFTR pAb (ATL-HPA021939) Datasheet (External Link)
Vendor Page Anti CFTR pAb (ATL-HPA021939)
Citations for Anti CFTR pAb (ATL-HPA021939) – 1 Found
Hiratsuka, Ken; Miyoshi, Tomoya; Kroll, Katharina T; Gupta, Navin R; Valerius, M Todd; Ferrante, Thomas; Yamashita, Michifumi; Lewis, Jennifer A; Morizane, Ryuji. Organoid-on-a-chip model of human ARPKD reveals mechanosensing pathomechanisms for drug discovery. Science Advances. 2022;8(38):eabq0866.  PubMed