Anti CFLAR pAb (ATL-HPA019044)

Atlas Antibodies

SKU: ATL-HPA019044-25

• 
• 

Protein Description: CASP8 and FADD-like apoptosis regulator
Gene Name: CFLAR
Alternative Gene Name: c-FLIP, CASH, CASP8AP1, Casper, CLARP, FLAME, FLIP, I-FLICE, MRIT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026031: 75%, ENSRNOG00000012473: 76%
Entrez Gene ID: 8837
Uniprot ID: O15519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSS
• Gene Sequence: IHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSS
• Gene ID - Mouse: ENSMUSG00000026031
• Gene ID - Rat: ENSRNOG00000012473
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CFLAR pAb (ATL-HPA019044) – 1 Found

Jones, David R; Moskaluk, Christopher A; Gillenwater, Heidi H; Petroni, Gina R; Burks, Sandra G; Philips, Jennifer; Rehm, Patrice K; Olazagasti, Juan; Kozower, Benjamin D; Bao, Yongde. Phase I trial of induction histone deacetylase and proteasome inhibition followed by surgery in non-small-cell lung cancer. Journal Of Thoracic Oncology : Official Publication Of The International Association For The Study Of Lung Cancer. 2012;7(11):1683-90.