Anti CFLAR pAb (ATL-HPA019044)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019044-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: CFLAR
Alternative Gene Name: c-FLIP, CASH, CASP8AP1, Casper, CLARP, FLAME, FLIP, I-FLICE, MRIT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026031: 75%, ENSRNOG00000012473: 76%
Entrez Gene ID: 8837
Uniprot ID: O15519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSS |
| Gene Sequence | IHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSS |
| Gene ID - Mouse | ENSMUSG00000026031 |
| Gene ID - Rat | ENSRNOG00000012473 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CFLAR pAb (ATL-HPA019044) | |
| Datasheet | Anti CFLAR pAb (ATL-HPA019044) Datasheet (External Link) |
| Vendor Page | Anti CFLAR pAb (ATL-HPA019044) at Atlas Antibodies |
| Documents & Links for Anti CFLAR pAb (ATL-HPA019044) | |
| Datasheet | Anti CFLAR pAb (ATL-HPA019044) Datasheet (External Link) |
| Vendor Page | Anti CFLAR pAb (ATL-HPA019044) |
| Citations for Anti CFLAR pAb (ATL-HPA019044) – 1 Found |
| Jones, David R; Moskaluk, Christopher A; Gillenwater, Heidi H; Petroni, Gina R; Burks, Sandra G; Philips, Jennifer; Rehm, Patrice K; Olazagasti, Juan; Kozower, Benjamin D; Bao, Yongde. Phase I trial of induction histone deacetylase and proteasome inhibition followed by surgery in non-small-cell lung cancer. Journal Of Thoracic Oncology : Official Publication Of The International Association For The Study Of Lung Cancer. 2012;7(11):1683-90. PubMed |