Anti CFI pAb (ATL-HPA024061)

Atlas Antibodies

Catalog No.:
ATL-HPA024061-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: complement factor I
Gene Name: CFI
Alternative Gene Name: C3b-INA, FI, IF, KAF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058952: 63%, ENSRNOG00000053400: 63%
Entrez Gene ID: 3426
Uniprot ID: P05156
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETSLAECTFTKRRTMGYQDFADVVCYTQKADSPMDDFFQCVNGKYISQMKACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAGFASVAQEETEILTADMDAERRRIKSLLPKLSC
Gene Sequence ETSLAECTFTKRRTMGYQDFADVVCYTQKADSPMDDFFQCVNGKYISQMKACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAGFASVAQEETEILTADMDAERRRIKSLLPKLSC
Gene ID - Mouse ENSMUSG00000058952
Gene ID - Rat ENSRNOG00000053400
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CFI pAb (ATL-HPA024061)
Datasheet Anti CFI pAb (ATL-HPA024061) Datasheet (External Link)
Vendor Page Anti CFI pAb (ATL-HPA024061) at Atlas Antibodies

Documents & Links for Anti CFI pAb (ATL-HPA024061)
Datasheet Anti CFI pAb (ATL-HPA024061) Datasheet (External Link)
Vendor Page Anti CFI pAb (ATL-HPA024061)
Citations for Anti CFI pAb (ATL-HPA024061) – 3 Found
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed
Dreismann, Anna K; McClements, Michelle E; Barnard, Alun R; Orhan, Elise; Hughes, Jane P; Lachmann, Peter J; MacLaren, Robert E. Functional expression of complement factor I following AAV-mediated gene delivery in the retina of mice and human cells. Gene Therapy. 2021;28(5):265-276.  PubMed
Sparreman Mikus, Maria; Kolmert, Johan; Andersson, Lars I; Östling, Jörgen; Knowles, Richard G; Gómez, Cristina; Ericsson, Magnus; Thörngren, John-Olof; Emami Khoonsari, Payam; Dahlén, Barbro; Kupczyk, Maciej; De Meulder, Bertrand; Auffray, Charles; Bakke, Per S; Beghe, Bianca; Bel, Elisabeth H; Caruso, Massimo; Chanez, Pascal; Chawes, Bo; Fowler, Stephen J; Gaga, Mina; Geiser, Thomas; Gjomarkaj, Mark; Horváth, Ildikó; Howarth, Peter H; Johnston, Sebastian L; Joos, Guy; Krug, Norbert; Montuschi, Paolo; Musial, Jacek; Niżankowska-Mogilnicka, Ewa; Olsson, Henric K; Papi, Alberto; Rabe, Klaus F; Sandström, Thomas; Shaw, Dominick E; Siafakas, Nikolaos M; Uhlén, Mathias; Riley, John H; Bates, Stewart; Middelveld, Roelinde J M; Wheelock, Craig E; Chung, Kian Fan; Adcock, Ian M; Sterk, Peter J; Djukanovic, Ratko; Nilsson, Peter; Dahlén, Sven-Erik; James, Anna. Plasma proteins elevated in severe asthma despite oral steroid use and unrelated to Type-2 inflammation. The European Respiratory Journal. 2022;59(2)  PubMed