Anti CFHR2 pAb (ATL-HPA049813)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049813-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CFHR2
Alternative Gene Name: CFHL2, FHR2, HFL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026365: 43%, ENSRNOG00000042369: 39%
Entrez Gene ID: 3080
Uniprot ID: P36980
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEE |
| Gene Sequence | KLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEE |
| Gene ID - Mouse | ENSMUSG00000026365 |
| Gene ID - Rat | ENSRNOG00000042369 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CFHR2 pAb (ATL-HPA049813) | |
| Datasheet | Anti CFHR2 pAb (ATL-HPA049813) Datasheet (External Link) |
| Vendor Page | Anti CFHR2 pAb (ATL-HPA049813) at Atlas Antibodies |
| Documents & Links for Anti CFHR2 pAb (ATL-HPA049813) | |
| Datasheet | Anti CFHR2 pAb (ATL-HPA049813) Datasheet (External Link) |
| Vendor Page | Anti CFHR2 pAb (ATL-HPA049813) |