Anti CFHR2 pAb (ATL-HPA049813)

Atlas Antibodies

Catalog No.:
ATL-HPA049813-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: complement factor H-related 2
Gene Name: CFHR2
Alternative Gene Name: CFHL2, FHR2, HFL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026365: 43%, ENSRNOG00000042369: 39%
Entrez Gene ID: 3080
Uniprot ID: P36980
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEE
Gene Sequence KLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEE
Gene ID - Mouse ENSMUSG00000026365
Gene ID - Rat ENSRNOG00000042369
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CFHR2 pAb (ATL-HPA049813)
Datasheet Anti CFHR2 pAb (ATL-HPA049813) Datasheet (External Link)
Vendor Page Anti CFHR2 pAb (ATL-HPA049813) at Atlas Antibodies

Documents & Links for Anti CFHR2 pAb (ATL-HPA049813)
Datasheet Anti CFHR2 pAb (ATL-HPA049813) Datasheet (External Link)
Vendor Page Anti CFHR2 pAb (ATL-HPA049813)