Anti CFHR1 pAb (ATL-HPA040726)

Atlas Antibodies

Catalog No.: ATL-HPA040726-25

Protein Description: complement factor H-related 1
Gene Name: CFHR1
Alternative Gene Name: CFHL, CFHL1, CFHL1P, CFHR1P, FHR1, H36-1, H36-2, HFL1, HFL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057037: 73%, ENSRNOG00000042901: 70%
Entrez Gene ID: 3078
Uniprot ID: Q03591
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWS
• Gene Sequence: YKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWS
• Gene ID - Mouse: ENSMUSG00000057037
• Gene ID - Rat: ENSRNOG00000042901
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.