Anti CFHR1 pAb (ATL-HPA038922)

Atlas Antibodies

SKU:
ATL-HPA038922-100
  • Immunohistochemical staining of human testis shows moderate extracellular space positivity in Leydig cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: complement factor H-related 1
Gene Name: CFHR1
Alternative Gene Name: CFHL, CFHL1, CFHL1P, CFHR1P, FHR1, H36-1, H36-2, HFL1, HFL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033898: 49%, ENSRNOG00000030715: 49%
Entrez Gene ID: 3078
Uniprot ID: Q03591
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TGESAEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCA
Gene Sequence TGESAEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCA
Gene ID - Mouse ENSMUSG00000033898
Gene ID - Rat ENSRNOG00000030715
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CFHR1 pAb (ATL-HPA038922)
Datasheet Anti CFHR1 pAb (ATL-HPA038922) Datasheet (External Link)
Vendor Page Anti CFHR1 pAb (ATL-HPA038922) at Atlas Antibodies

Documents & Links for Anti CFHR1 pAb (ATL-HPA038922)
Datasheet Anti CFHR1 pAb (ATL-HPA038922) Datasheet (External Link)
Vendor Page Anti CFHR1 pAb (ATL-HPA038922)