Anti CFDP1 pAb (ATL-HPA041316)

Atlas Antibodies

Catalog No.:
ATL-HPA041316-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: craniofacial development protein 1
Gene Name: CFDP1
Alternative Gene Name: BCNT, CENP-29, CP27, p97, SWC5, Yeti
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031954: 78%, ENSRNOG00000019326: 78%
Entrez Gene ID: 10428
Uniprot ID: Q9UEE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSE
Gene Sequence DEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSE
Gene ID - Mouse ENSMUSG00000031954
Gene ID - Rat ENSRNOG00000019326
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CFDP1 pAb (ATL-HPA041316)
Datasheet Anti CFDP1 pAb (ATL-HPA041316) Datasheet (External Link)
Vendor Page Anti CFDP1 pAb (ATL-HPA041316) at Atlas Antibodies

Documents & Links for Anti CFDP1 pAb (ATL-HPA041316)
Datasheet Anti CFDP1 pAb (ATL-HPA041316) Datasheet (External Link)
Vendor Page Anti CFDP1 pAb (ATL-HPA041316)