Anti CFDP1 pAb (ATL-HPA041316)

Atlas Antibodies

SKU: ATL-HPA041316-25

• 

Protein Description: craniofacial development protein 1
Gene Name: CFDP1
Alternative Gene Name: BCNT, CENP-29, CP27, p97, SWC5, Yeti
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031954: 78%, ENSRNOG00000019326: 78%
Entrez Gene ID: 10428
Uniprot ID: Q9UEE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSE
• Gene Sequence: DEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSE
• Gene ID - Mouse: ENSMUSG00000031954
• Gene ID - Rat: ENSRNOG00000019326
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.