Anti CFDP1 pAb (ATL-HPA041316)
Atlas Antibodies
- SKU:
- ATL-HPA041316-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CFDP1
Alternative Gene Name: BCNT, CENP-29, CP27, p97, SWC5, Yeti
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031954: 78%, ENSRNOG00000019326: 78%
Entrez Gene ID: 10428
Uniprot ID: Q9UEE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSE |
Gene Sequence | DEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSE |
Gene ID - Mouse | ENSMUSG00000031954 |
Gene ID - Rat | ENSRNOG00000019326 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CFDP1 pAb (ATL-HPA041316) | |
Datasheet | Anti CFDP1 pAb (ATL-HPA041316) Datasheet (External Link) |
Vendor Page | Anti CFDP1 pAb (ATL-HPA041316) at Atlas Antibodies |
Documents & Links for Anti CFDP1 pAb (ATL-HPA041316) | |
Datasheet | Anti CFDP1 pAb (ATL-HPA041316) Datasheet (External Link) |
Vendor Page | Anti CFDP1 pAb (ATL-HPA041316) |