Anti CFDP1 pAb (ATL-HPA041316)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041316-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CFDP1
Alternative Gene Name: BCNT, CENP-29, CP27, p97, SWC5, Yeti
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031954: 78%, ENSRNOG00000019326: 78%
Entrez Gene ID: 10428
Uniprot ID: Q9UEE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSE |
| Gene Sequence | DEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSE |
| Gene ID - Mouse | ENSMUSG00000031954 |
| Gene ID - Rat | ENSRNOG00000019326 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CFDP1 pAb (ATL-HPA041316) | |
| Datasheet | Anti CFDP1 pAb (ATL-HPA041316) Datasheet (External Link) |
| Vendor Page | Anti CFDP1 pAb (ATL-HPA041316) at Atlas Antibodies |
| Documents & Links for Anti CFDP1 pAb (ATL-HPA041316) | |
| Datasheet | Anti CFDP1 pAb (ATL-HPA041316) Datasheet (External Link) |
| Vendor Page | Anti CFDP1 pAb (ATL-HPA041316) |