Anti CFC1 pAb (ATL-HPA041773)

Atlas Antibodies

Catalog No.:
ATL-HPA041773-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cripto, FRL-1, cryptic family 1
Gene Name: CFC1
Alternative Gene Name: CRYPTIC, HTX2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047603: 29%, ENSRNOG00000018679: 33%
Entrez Gene ID: 55997
Uniprot ID: P0CG37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGWGPEEPLPYS
Gene Sequence YQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGWGPEEPLPYS
Gene ID - Mouse ENSMUSG00000047603
Gene ID - Rat ENSRNOG00000018679
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CFC1 pAb (ATL-HPA041773)
Datasheet Anti CFC1 pAb (ATL-HPA041773) Datasheet (External Link)
Vendor Page Anti CFC1 pAb (ATL-HPA041773) at Atlas Antibodies

Documents & Links for Anti CFC1 pAb (ATL-HPA041773)
Datasheet Anti CFC1 pAb (ATL-HPA041773) Datasheet (External Link)
Vendor Page Anti CFC1 pAb (ATL-HPA041773)