Anti CFC1 pAb (ATL-HPA041773)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041773-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CFC1
Alternative Gene Name: CRYPTIC, HTX2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047603: 29%, ENSRNOG00000018679: 33%
Entrez Gene ID: 55997
Uniprot ID: P0CG37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGWGPEEPLPYS |
Gene Sequence | YQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGWGPEEPLPYS |
Gene ID - Mouse | ENSMUSG00000047603 |
Gene ID - Rat | ENSRNOG00000018679 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CFC1 pAb (ATL-HPA041773) | |
Datasheet | Anti CFC1 pAb (ATL-HPA041773) Datasheet (External Link) |
Vendor Page | Anti CFC1 pAb (ATL-HPA041773) at Atlas Antibodies |
Documents & Links for Anti CFC1 pAb (ATL-HPA041773) | |
Datasheet | Anti CFC1 pAb (ATL-HPA041773) Datasheet (External Link) |
Vendor Page | Anti CFC1 pAb (ATL-HPA041773) |