Anti CFC1 pAb (ATL-HPA041773)

Atlas Antibodies

SKU: ATL-HPA041773-25

• 

Protein Description: cripto, FRL-1, cryptic family 1
Gene Name: CFC1
Alternative Gene Name: CRYPTIC, HTX2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047603: 29%, ENSRNOG00000018679: 33%
Entrez Gene ID: 55997
Uniprot ID: P0CG37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGWGPEEPLPYS
• Gene Sequence: YQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGWGPEEPLPYS
• Gene ID - Mouse: ENSMUSG00000047603
• Gene ID - Rat: ENSRNOG00000018679
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.