Anti CFB pAb (ATL-HPA001832)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001832-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CFB
Alternative Gene Name: BF, BFD, H2-Bf
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090231: 86%, ENSRNOG00000000419: 87%
Entrez Gene ID: 629
Uniprot ID: P00751
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIVLDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKVASYGVKPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKL |
Gene Sequence | RTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIVLDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKVASYGVKPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKL |
Gene ID - Mouse | ENSMUSG00000090231 |
Gene ID - Rat | ENSRNOG00000000419 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CFB pAb (ATL-HPA001832) | |
Datasheet | Anti CFB pAb (ATL-HPA001832) Datasheet (External Link) |
Vendor Page | Anti CFB pAb (ATL-HPA001832) at Atlas Antibodies |
Documents & Links for Anti CFB pAb (ATL-HPA001832) | |
Datasheet | Anti CFB pAb (ATL-HPA001832) Datasheet (External Link) |
Vendor Page | Anti CFB pAb (ATL-HPA001832) |
Citations for Anti CFB pAb (ATL-HPA001832) – 2 Found |
Singh, Madhu V; Kapoun, Ann; Higgins, Linda; Kutschke, William; Thurman, Joshua M; Zhang, Rong; Singh, Minati; Yang, Jinying; Guan, Xiaoqun; Lowe, John S; Weiss, Robert M; Zimmermann, Kathy; Yull, Fiona E; Blackwell, Timothy S; Mohler, Peter J; Anderson, Mark E. Ca2+/calmodulin-dependent kinase II triggers cell membrane injury by inducing complement factor B gene expression in the mouse heart. The Journal Of Clinical Investigation. 2009;119(4):986-96. PubMed |
Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |