Anti CFB pAb (ATL-HPA001817)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001817-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CFB
Alternative Gene Name: BF, BFD, H2-Bf
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090231: 86%, ENSRNOG00000000419: 81%
Entrez Gene ID: 629
Uniprot ID: P00751
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYG |
| Gene Sequence | KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYG |
| Gene ID - Mouse | ENSMUSG00000090231 |
| Gene ID - Rat | ENSRNOG00000000419 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CFB pAb (ATL-HPA001817) | |
| Datasheet | Anti CFB pAb (ATL-HPA001817) Datasheet (External Link) |
| Vendor Page | Anti CFB pAb (ATL-HPA001817) at Atlas Antibodies |
| Documents & Links for Anti CFB pAb (ATL-HPA001817) | |
| Datasheet | Anti CFB pAb (ATL-HPA001817) Datasheet (External Link) |
| Vendor Page | Anti CFB pAb (ATL-HPA001817) |
| Citations for Anti CFB pAb (ATL-HPA001817) – 5 Found |
| Bettoni, Serena; Bresin, Elena; Remuzzi, Giuseppe; Noris, Marina; Donadelli, Roberta. Insights into the Effects of Complement Factor H on the Assembly and Decay of the Alternative Pathway C3 Proconvertase and C3 Convertase. The Journal Of Biological Chemistry. 2016;291(15):8214-30. PubMed |
| Grossman, Tamar R; Carrer, Michele; Shen, Lijiang; Johnson, Robert B; Hettrick, Lisa A; Henry, Scott P; Monia, Brett P; McCaleb, Michael L. Reduction in ocular complement factor B protein in mice and monkeys by systemic administration of factor B antisense oligonucleotide. Molecular Vision. 23( 28855795):561-571. PubMed |
| Singh, Madhu V; Kapoun, Ann; Higgins, Linda; Kutschke, William; Thurman, Joshua M; Zhang, Rong; Singh, Minati; Yang, Jinying; Guan, Xiaoqun; Lowe, John S; Weiss, Robert M; Zimmermann, Kathy; Yull, Fiona E; Blackwell, Timothy S; Mohler, Peter J; Anderson, Mark E. Ca2+/calmodulin-dependent kinase II triggers cell membrane injury by inducing complement factor B gene expression in the mouse heart. The Journal Of Clinical Investigation. 2009;119(4):986-96. PubMed |
| Cima, Igor; Schiess, Ralph; Wild, Peter; Kaelin, Martin; Schüffler, Peter; Lange, Vinzenz; Picotti, Paola; Ossola, Reto; Templeton, Arnoud; Schubert, Olga; Fuchs, Thomas; Leippold, Thomas; Wyler, Stephen; Zehetner, Jens; Jochum, Wolfram; Buhmann, Joachim; Cerny, Thomas; Moch, Holger; Gillessen, Silke; Aebersold, Ruedi; Krek, Wilhelm. Cancer genetics-guided discovery of serum biomarker signatures for diagnosis and prognosis of prostate cancer. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2011;108(8):3342-7. PubMed |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |