Anti CFB pAb (ATL-HPA000951)

Atlas Antibodies

Catalog No.:
ATL-HPA000951-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: complement factor B
Gene Name: CFB
Alternative Gene Name: BF, BFD, H2-Bf
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000092511: 82%, ENSRNOG00000000419: 79%
Entrez Gene ID: 629
Uniprot ID: P00751
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVV
Gene Sequence VDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVV
Gene ID - Mouse ENSMUSG00000092511
Gene ID - Rat ENSRNOG00000000419
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CFB pAb (ATL-HPA000951)
Datasheet Anti CFB pAb (ATL-HPA000951) Datasheet (External Link)
Vendor Page Anti CFB pAb (ATL-HPA000951) at Atlas Antibodies

Documents & Links for Anti CFB pAb (ATL-HPA000951)
Datasheet Anti CFB pAb (ATL-HPA000951) Datasheet (External Link)
Vendor Page Anti CFB pAb (ATL-HPA000951)
Citations for Anti CFB pAb (ATL-HPA000951) – 2 Found
Häggmark, Anna; Neiman, Maja; Drobin, Kimi; Zwahlen, Martin; Uhlén, Mathias; Nilsson, Peter; Schwenk, Jochen M. Classification of protein profiles from antibody microarrays using heat and detergent treatment. New Biotechnology. 2012;29(5):564-70.  PubMed
Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73.  PubMed