Anti CFB pAb (ATL-HPA000951)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000951-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CFB
Alternative Gene Name: BF, BFD, H2-Bf
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000092511: 82%, ENSRNOG00000000419: 79%
Entrez Gene ID: 629
Uniprot ID: P00751
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVV |
| Gene Sequence | VDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVV |
| Gene ID - Mouse | ENSMUSG00000092511 |
| Gene ID - Rat | ENSRNOG00000000419 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CFB pAb (ATL-HPA000951) | |
| Datasheet | Anti CFB pAb (ATL-HPA000951) Datasheet (External Link) |
| Vendor Page | Anti CFB pAb (ATL-HPA000951) at Atlas Antibodies |
| Documents & Links for Anti CFB pAb (ATL-HPA000951) | |
| Datasheet | Anti CFB pAb (ATL-HPA000951) Datasheet (External Link) |
| Vendor Page | Anti CFB pAb (ATL-HPA000951) |
| Citations for Anti CFB pAb (ATL-HPA000951) – 2 Found |
| Häggmark, Anna; Neiman, Maja; Drobin, Kimi; Zwahlen, Martin; Uhlén, Mathias; Nilsson, Peter; Schwenk, Jochen M. Classification of protein profiles from antibody microarrays using heat and detergent treatment. New Biotechnology. 2012;29(5):564-70. PubMed |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |