Anti CFAP97 pAb (ATL-HPA053335)

Atlas Antibodies

SKU:
ATL-HPA053335-25
  • Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoli fibrillar center.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cilia and flagella associated protein 97
Gene Name: CFAP97
Alternative Gene Name: DKFZp434F1728, hmw, KIAA1430
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031631: 67%, ENSRNOG00000032192: 66%
Entrez Gene ID: 57587
Uniprot ID: Q9P2B7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SFELGIANDQKVKIKKQENVSQEIYEDVEDLKNNSKYLKAAKKGKEKHEPDVSSKSSSVLDSSLDHRHKQKVLHDTMDLNHLLKA
Gene Sequence SFELGIANDQKVKIKKQENVSQEIYEDVEDLKNNSKYLKAAKKGKEKHEPDVSSKSSSVLDSSLDHRHKQKVLHDTMDLNHLLKA
Gene ID - Mouse ENSMUSG00000031631
Gene ID - Rat ENSRNOG00000032192
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CFAP97 pAb (ATL-HPA053335)
Datasheet Anti CFAP97 pAb (ATL-HPA053335) Datasheet (External Link)
Vendor Page Anti CFAP97 pAb (ATL-HPA053335) at Atlas Antibodies

Documents & Links for Anti CFAP97 pAb (ATL-HPA053335)
Datasheet Anti CFAP97 pAb (ATL-HPA053335) Datasheet (External Link)
Vendor Page Anti CFAP97 pAb (ATL-HPA053335)