Anti CFAP91 pAb (ATL-HPA074084 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA074084-25
  • Immunohistochemistry analysis in human fallopian tube and liver tissues using Anti-MAATS1 antibody. Corresponding MAATS1 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: MYCBP associated and testis expressed 1
Gene Name: CFAP91
Alternative Gene Name: AAT1, AAT1alpha, C3orf15, CaM-IP2, SPATA26, MAATS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022805: 83%, ENSRNOG00000002976: 81%
Entrez Gene ID: 89876
Uniprot ID: Q7Z4T9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DFLSKELVRLQEERRIHAFVMLAERQRRVREAEESGRRQVEKQRLREEDEIFKEVVKVHHSTISSYLEDIILNTEANT
Gene Sequence DFLSKELVRLQEERRIHAFVMLAERQRRVREAEESGRRQVEKQRLREEDEIFKEVVKVHHSTISSYLEDIILNTEANT
Gene ID - Mouse ENSMUSG00000022805
Gene ID - Rat ENSRNOG00000002976
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CFAP91 pAb (ATL-HPA074084 w/enhanced validation)
Datasheet Anti CFAP91 pAb (ATL-HPA074084 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CFAP91 pAb (ATL-HPA074084 w/enhanced validation)