Anti CFAP77 pAb (ATL-HPA021329 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA021329-25

• 
• 

Protein Description: cilia and flagella associated protein 77
Gene Name: CFAP77
Alternative Gene Name: C9orf171, FLJ46082
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079502: 90%, ENSRNOG00000028805: 88%
Entrez Gene ID: 389799
Uniprot ID: Q6ZQR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKKQKVVLGKLYETRSSQLRKYKPPVKLDTLWHMPHFQKVGRHLDTFPTEADRQRALKAHREECAVRQGTLRMGNYTH
• Gene Sequence: EKKQKVVLGKLYETRSSQLRKYKPPVKLDTLWHMPHFQKVGRHLDTFPTEADRQRALKAHREECAVRQGTLRMGNYTH
• Gene ID - Mouse: ENSMUSG00000079502
• Gene ID - Rat: ENSRNOG00000028805
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.