Anti CFAP74 pAb (ATL-HPA029274 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA029274-25

• 

Protein Description: cilia and flagella associated protein 74
Gene Name: CFAP74
Alternative Gene Name: C1orf222, FLJ45476, KIAA1751
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078490: 64%, ENSRNOG00000042235: 69%
Entrez Gene ID: 85452
Uniprot ID: Q9C0B2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDVPVESLTAIPVFDPRHREASSRPGPLSPEAEELRPILVTLDYIQFDTDTPAPPATRELQVGCIRTTQPSPKK
• Gene Sequence: LDVPVESLTAIPVFDPRHREASSRPGPLSPEAEELRPILVTLDYIQFDTDTPAPPATRELQVGCIRTTQPSPKK
• Gene ID - Mouse: ENSMUSG00000078490
• Gene ID - Rat: ENSRNOG00000042235
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.