Anti CFAP70 pAb (ATL-HPA037582)

Atlas Antibodies

Catalog No.:
ATL-HPA037582-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cilia and flagella associated protein 70
Gene Name: CFAP70
Alternative Gene Name: FLJ25765, TTC18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039543: 81%, ENSRNOG00000007046: 76%
Entrez Gene ID: 118491
Uniprot ID: Q5T0N1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AVVDLLPLLEGQSSFQTTVPLHPVQGSPLETPRSSAKQCSLEVKVLVAEPLLTTAQISGGNLLKVTLEAAYSVPESFIPTGPGQ
Gene Sequence AVVDLLPLLEGQSSFQTTVPLHPVQGSPLETPRSSAKQCSLEVKVLVAEPLLTTAQISGGNLLKVTLEAAYSVPESFIPTGPGQ
Gene ID - Mouse ENSMUSG00000039543
Gene ID - Rat ENSRNOG00000007046
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CFAP70 pAb (ATL-HPA037582)
Datasheet Anti CFAP70 pAb (ATL-HPA037582) Datasheet (External Link)
Vendor Page Anti CFAP70 pAb (ATL-HPA037582) at Atlas Antibodies

Documents & Links for Anti CFAP70 pAb (ATL-HPA037582)
Datasheet Anti CFAP70 pAb (ATL-HPA037582) Datasheet (External Link)
Vendor Page Anti CFAP70 pAb (ATL-HPA037582)
Citations for Anti CFAP70 pAb (ATL-HPA037582) – 1 Found
Shamoto, Noritoshi; Narita, Keishi; Kubo, Tomohiro; Oda, Toshiyuki; Takeda, Sen. CFAP70 Is a Novel Axoneme-Binding Protein That Localizes at the Base of the Outer Dynein Arm and Regulates Ciliary Motility. Cells. 2018;7(9)  PubMed