Anti CFAP70 pAb (ATL-HPA037582)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037582-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CFAP70
Alternative Gene Name: FLJ25765, TTC18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039543: 81%, ENSRNOG00000007046: 76%
Entrez Gene ID: 118491
Uniprot ID: Q5T0N1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AVVDLLPLLEGQSSFQTTVPLHPVQGSPLETPRSSAKQCSLEVKVLVAEPLLTTAQISGGNLLKVTLEAAYSVPESFIPTGPGQ |
| Gene Sequence | AVVDLLPLLEGQSSFQTTVPLHPVQGSPLETPRSSAKQCSLEVKVLVAEPLLTTAQISGGNLLKVTLEAAYSVPESFIPTGPGQ |
| Gene ID - Mouse | ENSMUSG00000039543 |
| Gene ID - Rat | ENSRNOG00000007046 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CFAP70 pAb (ATL-HPA037582) | |
| Datasheet | Anti CFAP70 pAb (ATL-HPA037582) Datasheet (External Link) |
| Vendor Page | Anti CFAP70 pAb (ATL-HPA037582) at Atlas Antibodies |
| Documents & Links for Anti CFAP70 pAb (ATL-HPA037582) | |
| Datasheet | Anti CFAP70 pAb (ATL-HPA037582) Datasheet (External Link) |
| Vendor Page | Anti CFAP70 pAb (ATL-HPA037582) |
| Citations for Anti CFAP70 pAb (ATL-HPA037582) – 1 Found |
| Shamoto, Noritoshi; Narita, Keishi; Kubo, Tomohiro; Oda, Toshiyuki; Takeda, Sen. CFAP70 Is a Novel Axoneme-Binding Protein That Localizes at the Base of the Outer Dynein Arm and Regulates Ciliary Motility. Cells. 2018;7(9) PubMed |