Anti CFAP69 pAb (ATL-HPA062883)

Atlas Antibodies

Catalog No.:
ATL-HPA062883-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: cilia and flagella associated protein 69
Gene Name: CFAP69
Alternative Gene Name: C7orf63, FAP69, FLJ21062
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040473: 82%, ENSRNOG00000006114: 81%
Entrez Gene ID: 79846
Uniprot ID: A5D8W1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDVSENIRAKIYAILGKLDFENLPGLSAEDFVTLCIIHRYLDFKIGEIWNEIYEEIKLEKLRPVTTDKKALEAITTASENIGKMVASLQSDIIESQA
Gene Sequence MDVSENIRAKIYAILGKLDFENLPGLSAEDFVTLCIIHRYLDFKIGEIWNEIYEEIKLEKLRPVTTDKKALEAITTASENIGKMVASLQSDIIESQA
Gene ID - Mouse ENSMUSG00000040473
Gene ID - Rat ENSRNOG00000006114
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CFAP69 pAb (ATL-HPA062883)
Datasheet Anti CFAP69 pAb (ATL-HPA062883) Datasheet (External Link)
Vendor Page Anti CFAP69 pAb (ATL-HPA062883) at Atlas Antibodies

Documents & Links for Anti CFAP69 pAb (ATL-HPA062883)
Datasheet Anti CFAP69 pAb (ATL-HPA062883) Datasheet (External Link)
Vendor Page Anti CFAP69 pAb (ATL-HPA062883)