Anti CFAP69 pAb (ATL-HPA062883)

Atlas Antibodies

Catalog No.: ATL-HPA062883-25

Protein Description: cilia and flagella associated protein 69
Gene Name: CFAP69
Alternative Gene Name: C7orf63, FAP69, FLJ21062
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040473: 82%, ENSRNOG00000006114: 81%
Entrez Gene ID: 79846
Uniprot ID: A5D8W1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDVSENIRAKIYAILGKLDFENLPGLSAEDFVTLCIIHRYLDFKIGEIWNEIYEEIKLEKLRPVTTDKKALEAITTASENIGKMVASLQSDIIESQA
• Gene Sequence: MDVSENIRAKIYAILGKLDFENLPGLSAEDFVTLCIIHRYLDFKIGEIWNEIYEEIKLEKLRPVTTDKKALEAITTASENIGKMVASLQSDIIESQA
• Gene ID - Mouse: ENSMUSG00000040473
• Gene ID - Rat: ENSRNOG00000006114
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.