Anti CFAP61 pAb (ATL-HPA009079)
Atlas Antibodies
- Catalog No.:
- ATL-HPA009079-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CFAP61
Alternative Gene Name: C20orf26, CaM-IP3, dJ1002M8.3, DKFZP434K156
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037143: 79%, ENSRNOG00000050239: 17%
Entrez Gene ID: 26074
Uniprot ID: Q8NHU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HMKFNNLTLISTHGLPGKKLLDTEQRKFLASDHCFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLSTDEIVPYDHLILCTGQQYQVPCPTEADISQHLTNREVPNSSQRRYTGKVPCNHFTLNEEEDCFKALIWIRNNSITTE |
Gene Sequence | HMKFNNLTLISTHGLPGKKLLDTEQRKFLASDHCFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLSTDEIVPYDHLILCTGQQYQVPCPTEADISQHLTNREVPNSSQRRYTGKVPCNHFTLNEEEDCFKALIWIRNNSITTE |
Gene ID - Mouse | ENSMUSG00000037143 |
Gene ID - Rat | ENSRNOG00000050239 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CFAP61 pAb (ATL-HPA009079) | |
Datasheet | Anti CFAP61 pAb (ATL-HPA009079) Datasheet (External Link) |
Vendor Page | Anti CFAP61 pAb (ATL-HPA009079) at Atlas Antibodies |
Documents & Links for Anti CFAP61 pAb (ATL-HPA009079) | |
Datasheet | Anti CFAP61 pAb (ATL-HPA009079) Datasheet (External Link) |
Vendor Page | Anti CFAP61 pAb (ATL-HPA009079) |
Citations for Anti CFAP61 pAb (ATL-HPA009079) – 1 Found |
Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. PubMed |