Anti CFAP58 pAb (ATL-HPA036555)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036555-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CFAP58
Alternative Gene Name: bA554P13.1, C10orf80, CCDC147, FLJ35908
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046585: 83%, ENSRNOG00000053565: 84%
Entrez Gene ID: 159686
Uniprot ID: Q5T655
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EKGGKQVLEESAFEEMERDFQGVLHELSGDKSLEKFRIEYERLHAVMKKSYDNEKRLMAKCRELNAEIVVNSAKVATALKLSQDDQTTIASLKKE |
| Gene Sequence | EKGGKQVLEESAFEEMERDFQGVLHELSGDKSLEKFRIEYERLHAVMKKSYDNEKRLMAKCRELNAEIVVNSAKVATALKLSQDDQTTIASLKKE |
| Gene ID - Mouse | ENSMUSG00000046585 |
| Gene ID - Rat | ENSRNOG00000053565 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CFAP58 pAb (ATL-HPA036555) | |
| Datasheet | Anti CFAP58 pAb (ATL-HPA036555) Datasheet (External Link) |
| Vendor Page | Anti CFAP58 pAb (ATL-HPA036555) at Atlas Antibodies |
| Documents & Links for Anti CFAP58 pAb (ATL-HPA036555) | |
| Datasheet | Anti CFAP58 pAb (ATL-HPA036555) Datasheet (External Link) |
| Vendor Page | Anti CFAP58 pAb (ATL-HPA036555) |