Anti CFAP58 pAb (ATL-HPA036555)

Atlas Antibodies

Catalog No.: ATL-HPA036555-25

Protein Description: cilia and flagella associated protein 58
Gene Name: CFAP58
Alternative Gene Name: bA554P13.1, C10orf80, CCDC147, FLJ35908
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046585: 83%, ENSRNOG00000053565: 84%
Entrez Gene ID: 159686
Uniprot ID: Q5T655
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKGGKQVLEESAFEEMERDFQGVLHELSGDKSLEKFRIEYERLHAVMKKSYDNEKRLMAKCRELNAEIVVNSAKVATALKLSQDDQTTIASLKKE
• Gene Sequence: EKGGKQVLEESAFEEMERDFQGVLHELSGDKSLEKFRIEYERLHAVMKKSYDNEKRLMAKCRELNAEIVVNSAKVATALKLSQDDQTTIASLKKE
• Gene ID - Mouse: ENSMUSG00000046585
• Gene ID - Rat: ENSRNOG00000053565
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.