Anti CFAP58 pAb (ATL-HPA036555)

Atlas Antibodies

SKU:
ATL-HPA036555-25
  • Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in inflammatory cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cilia and flagella associated protein 58
Gene Name: CFAP58
Alternative Gene Name: bA554P13.1, C10orf80, CCDC147, FLJ35908
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046585: 83%, ENSRNOG00000053565: 84%
Entrez Gene ID: 159686
Uniprot ID: Q5T655
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKGGKQVLEESAFEEMERDFQGVLHELSGDKSLEKFRIEYERLHAVMKKSYDNEKRLMAKCRELNAEIVVNSAKVATALKLSQDDQTTIASLKKE
Gene Sequence EKGGKQVLEESAFEEMERDFQGVLHELSGDKSLEKFRIEYERLHAVMKKSYDNEKRLMAKCRELNAEIVVNSAKVATALKLSQDDQTTIASLKKE
Gene ID - Mouse ENSMUSG00000046585
Gene ID - Rat ENSRNOG00000053565
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CFAP58 pAb (ATL-HPA036555)
Datasheet Anti CFAP58 pAb (ATL-HPA036555) Datasheet (External Link)
Vendor Page Anti CFAP58 pAb (ATL-HPA036555) at Atlas Antibodies

Documents & Links for Anti CFAP58 pAb (ATL-HPA036555)
Datasheet Anti CFAP58 pAb (ATL-HPA036555) Datasheet (External Link)
Vendor Page Anti CFAP58 pAb (ATL-HPA036555)