Anti CFAP57 pAb (ATL-HPA028623 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA028623-25

• 
• 

Protein Description: cilia and flagella associated protein 57
Gene Name: CFAP57
Alternative Gene Name: FLJ32000, WDR65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028730: 70%, ENSRNOG00000033065: 28%
Entrez Gene ID: 149465
Uniprot ID: Q96MR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKLTKKVRPQEVSETEPSRDMLSTAPTARLNEQEETGRIIEMQRLEIQRLRDQIQEQEQVTGFHTLAGVRLPSLSNSEVDLEVKTN
• Gene Sequence: LKLTKKVRPQEVSETEPSRDMLSTAPTARLNEQEETGRIIEMQRLEIQRLRDQIQEQEQVTGFHTLAGVRLPSLSNSEVDLEVKTN
• Gene ID - Mouse: ENSMUSG00000028730
• Gene ID - Rat: ENSRNOG00000033065
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.