Anti CFAP54 pAb (ATL-HPA039897 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA039897-25
  • Immunohistochemistry analysis in human fallopian tube and placenta tissues using HPA039897 antibody. Corresponding CFAP54 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & microtubules.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cilia and flagella associated 54
Gene Name: CFAP54
Alternative Gene Name: C12orf55, C12orf63, FLJ31514, FLJ44112
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020014: 78%, ENSRNOG00000029837: 77%
Entrez Gene ID: 144535
Uniprot ID: Q96N23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CQMKEYKLALLQCYGRYLQQFNTNFDENKVDVTQFKATFFPKGFKDKTAGLTFHALSGKNMCNYQLVCDSDENLKNKESVVQCLHILSSLRLIMQVA
Gene Sequence CQMKEYKLALLQCYGRYLQQFNTNFDENKVDVTQFKATFFPKGFKDKTAGLTFHALSGKNMCNYQLVCDSDENLKNKESVVQCLHILSSLRLIMQVA
Gene ID - Mouse ENSMUSG00000020014
Gene ID - Rat ENSRNOG00000029837
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CFAP54 pAb (ATL-HPA039897 w/enhanced validation)
Datasheet Anti CFAP54 pAb (ATL-HPA039897 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CFAP54 pAb (ATL-HPA039897 w/enhanced validation)